Tested Applications
| Positive WB detected in | HeLa cells, human testis tissue, 143B cells, DU145 cells, SiHa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
87480-1-RR targets LY6K in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg5676 Product name: Recombinant Human LY6K protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 18-138 aa of NM_017527.3 Sequence: DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG Predict reactive species |
| Full Name | lymphocyte antigen 6 complex, locus K |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 18-26 kDa |
| GenBank Accession Number | NM_017527.3 |
| Gene Symbol | LY6K |
| Gene ID (NCBI) | 54742 |
| RRID | AB_3745570 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q17RY6-1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The LY6K (Lymphocyte antigen 6K) protein belongs to the LY6/uPAR superfamily and is a class of small glycoproteins that are anchored to the outer side of the cell membrane via glycosylphosphatidylinositol (GPI).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for LY6K antibody 87480-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



