LY6K Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• LY6K Recombinant monoclonal antibody, PBS Only (87480-1-PBS)

• 

  WB analysis using 87480-1-RR (same clone as 87480-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87480-1-RR (LY6K antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87480-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87480-1-RR (same clone as 87480-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87480-1-RR (LY6K antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87480-1-PBS in a different storage buffer formulation.

LY6K Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87480-1-PBS

Clone No.252714A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CO16, HSJ001348, Ly 6K, Ly-6K, Lymphocyte antigen 6K

---

Product Information

87480-1-PBS targets LY6K in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5676

  Product name: Recombinant human LY6K protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 18-138 aa of NM_017527.3

  Sequence: DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG

• Full Name: lymphocyte antigen 6 complex, locus K
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18-26 kDa
• GenBank Accession Number: NM_017527.3
• Gene Symbol: LY6K
• Gene ID (NCBI): 54742
• RRID: AB_3745570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q17RY6-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The LY6K (Lymphocyte antigen 6K) protein belongs to the LY6/uPAR superfamily and is a class of small glycoproteins that are anchored to the outer side of the cell membrane via glycosylphosphatidylinositol (GPI).