Use Able AI chat for product recommendations

JAM3 Recombinant monoclonal antibody, PBS Only (Detector)

JAM3 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 86960-1-PBS
Clone No.251954C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

JAM-2, JAM-3, JAM-C, Junctional adhesion molecule 3, Junctional adhesion molecule C

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86960-1-PBS targets JAM3 as part of a matched antibody pair:

MP02796-1: 86960-2-PBS capture and 86960-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg6611

Product name: Recombinant Human JAM3 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 32-241 aa of NM_032801.5

Sequence: VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN

Predict reactive species
Full Name junctional adhesion molecule 3
Calculated Molecular Weight35 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberNM_032801.5
Gene Symbol JAM3
Gene ID (NCBI) 83700
RRIDAB_3745236
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BX67-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Junctional adhesion molecule 3 (JAM3) is a type I transmembrane glycoprotein containing two Ig-like domains, which is expressed in various tissues and plays a crucial role in cell junctions, cell polarity, and motility (PMID: 34292449; 28931565). It has been proposed that JAM3 participates in leukocyte-platelet interactions, as well as angiogenesis and brain development (PMID: 12208882; 23255084). JAM3 may also be a new marker for predicting the prognosis and immune functions of bladder cancer patients (PMID: 38400838).

Loading...
||
New chat

Able

正在加载,请稍候...