LSM14A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LSM14A Polyclonal antibody (33966-1-AP)

• 

  WB analysis using 33966-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33966-1-AP (LSM14A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 33966-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LSM14A antibody (33966-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

LSM14A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 33966-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

AlphaSNBP, C19orf13, FAM61A, hRAP55, hRAP55A

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, HepG2 cells, L02 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33966-1-AP targets LSM14A in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41250

  Product name: Recombinant human LSM14A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 108-219 aa of BC016842

  Sequence: MGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVS

• Full Name: LSM14A, SCD6 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 463 aa, 51 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC016842
• Gene Symbol: LSM14A
• Gene ID (NCBI): 26065
• RRID: AB_3743127
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8ND56
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LSm14A was originally discovered to be a component of the P-bodies, it is a member of the LSm family of proteins, which have been shown to be involved in RNA processing events. The N terminus of LSm14A is a conserved LSm domain, whereas the C terminus contains two domains called "DFDF box" and "FDF_TFG box", respectively.