RHOBTB3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RHOBTB3 Polyclonal antibody (13945-1-AP)

RHOBTB3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13945-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

KIAA0878, RHOBTB3

• 

  WB analysis using 13945-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13945-1-AP (RHOBTB3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 13945-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13945-1-AP (RHOBTB3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 13945-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13945-1-AP (RHOBTB3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat adrenal gland using 13945-1-AP

  Immunohistochemical analysis of paraffin-embedded rat adrenal gland tissue slide using 13945-1-AP (RHOBTB3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 13945-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13945-1-AP (RHOBTB3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RHOBTB3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, K-562 cells
• Positive IHC detected in: mouse heart tissue, human placenta tissue, rat adrenal gland tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13945-1-AP targets RHOBTB3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5025

  Product name: Recombinant human RHOBTB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-359 aa of BC041337

  Sequence: MSIHIVALGNEGDTFHQDNQPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQASAFGNVKLVVHDCPVWDIFDSDWYTSRNLIGGADIIVIKYNVNDKFSFHEVKDNYIPVIKRALNSVPVIIAAVGTRQNEELPCTCPLCTSDRGSCVSTTEGIQLAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQALNQKTSEKMKKRKMSNSFHGIRPPQLEQPEKMPVLKAEASHYNSDLNNLLFCCQCVDVVFYNPDLKKVVEAHKIVLCAVSHVFMLLFNVKSPTDIQDSSIIRTTQDLFAINRDTAFPGASHESSGNPPLRVIVKDALFCSCLSDILRFIYSGAFQWEELEE

• Full Name: Rho-related BTB domain containing 3
• Calculated Molecular Weight: 611 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC041337
• Gene Symbol: RHOBTB3
• Gene ID (NCBI): 22836
• RRID: AB_2877992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94955
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RHOBTB3 Polyclonal antibody (Cat# 13945-1-AP) has 4 total citations. These appear in Nature Chemistry, Theranostics, Phytomedicine, and Cells. The research fields span protein degradation via E3 ligase-mediated pathways, colorectal cancer metastasis regulation, hypoxia-inducible factor ubiquitination in skin biology, and autophagy regulation through AMBRA1 stability. Applications cited include WB, IHC, IF, and IP in human and mouse samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Chem; Monovalent pseudo-natural products supercharge degradation of IDO1 by its native E3 KLHDC3.; Authors - Elisabeth Hennes
human	WB	Theranostics; Circular RNA circRHOBTB3 represses metastasis by regulating the HuR-mediated mRNA stability of PTBP1 in colorectal cancer.; Authors - Jiaxin Chen
human,mouse	WB,IHC,IF	Phytomedicine; Diosmetin attenuates the ubiquitination of epidermal hypoxia-inducible factor 1 alpha by diminishing the formation of RhoBTB3/PHD2 complex in ultraviolet radiation-induced sunburn in mice; Authors - Xiaobao Gong
human	WB,IP	Cells; RhoBTB3 Functions as a Novel Regulator of Autophagy by Suppressing AMBRA1 Stability; Authors - Kyungho Kim