Home
Products
Primary Antibodies
Recombinant Antibodies
TMEM119 Recombinant monoclonal antibody, PBS Only (83448-9-PBS)

TMEM119 Recombinant monoclonal antibody, PBS Only

Name: TMEM119 Recombinant monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 83448-9-PBS-100UG

TMEM119 Uni-rAb^® Recombinant Antibody for IHC, IF-P, Indirect ELISA

Cat No. 83448-9-PBS

Clone No.251557E2

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

OBIF, Osteoblast induction factor, transmembrane protein 119, UNQ731/PRO1415

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHCIF-PAffinity

IHC staining of Human brain cancer（Astrocitoma） using 83448-9-RR (same clone as 83448-9-PBS)
Immunohistochemical analysis of paraffin-embedded Human brain cancer(Astrocitoma) slide using 83448-9-RR (TMEM119 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83448-9-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 83448-9-RR (same clone as 83448-9-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83448-9-RR (TMEM119 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83448-9-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse brain using 83448-9-RR (same clone as 83448-9-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83448-9-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83448-9-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 83448-9-RR (same clone as 83448-9-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83448-9-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83448-9-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 83448-9-RR (same clone as 83448-9-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite® Plus 647 IBA1 antibody (CL647-81728, Clone: 4D5, Magenta), GFAP antibody (60190-1-Ig, Clone: 4B2E10, orange). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83448-9-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite® Plus 647 IBA1 antibody (CL647-81728, Clone: 4D5, Magenta), GFAP antibody (60190-1-Ig, Clone: 4B2E10, orange). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83448-9-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 83448-9-RR (same clone as 83448-9-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite® Plus 647 IBA1 antibody (CL647-81728, Clone: 4D5, Magenta), GFAP antibody (60190-1-Ig, Clone: 4B2E10, orange). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83448-9-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite® Plus 647 IBA1 antibody (CL647-81728, Clone: 4D5, Magenta), GFAP antibody (60190-1-Ig, Clone: 4B2E10, orange). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83448-9-PBS in a different storage buffer formulation.
Affinity of 83448-9-RR
Biolayer interferometry (BLI) kinetic assays of 83448-9-RR against Human TMEM119 were performed. The affinity constant is 3.12 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

83448-9-PBS targets TMEM119 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1823 Product name: Recombinant human TMEM119 protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-96 aa of NM_181724 Sequence: RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM Predict reactive species
Full Name	transmembrane protein 119
Calculated Molecular Weight	29 kDa
GenBank Accession Number	NM_181724
Gene Symbol	TMEM119
Gene ID (NCBI)	338773
RRID	AB_3743479
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q4V9L6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Transmembrane protein 119 (TMEM119), was characterized to be a specific microglia marker by Bennet et al. in 2016, although its function in microglia remains unknown. It is considered to be a marker expressed by microglia under homeostatic conditions based on transcriptomic findings . Under pathological conditions, the immune-specialized brain microenvironment contains both resident microglia and bone marrow-derived myeloid cells recruited from peripheral circulation. Recently, transmembrane protein 119 (TMEM119) has been reported as a marker for resident microglia which is not expressed by bone marrow-derived myeloid cells. (PMID: 35247551, PMID: 38308250, PMID: 40373772)