Home
Products
Primary Antibodies
Recombinant Antibodies
TMEM119 Recombinant monoclonal antibody (83448-9-RR)

TMEM119 Recombinant monoclonal antibody

TMEM119 Uni-rAb^® Recombinant Antibody for IHC, IF-P, ELISA

Cat No. 83448-9-RR

Clone No.251557E2

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, ELISA

Synonyms

OBIF, Osteoblast induction factor, transmembrane protein 119, UNQ731/PRO1415

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 647

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHCIF-PAffinity

IHC staining of Human brain cancer（Astrocitoma） using 83448-9-RR
Immunohistochemical analysis of paraffin-embedded Human brain cancer(Astrocitoma) slide using 83448-9-RR (TMEM119 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 83448-9-RR
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83448-9-RR (TMEM119 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse brain using 83448-9-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse brain using 83448-9-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse brain using 83448-9-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite® Plus 647 IBA1 antibody (CL647-81728, Clone: 4D5, Magenta), GFAP antibody (60190-1-Ig, Clone: 4B2E10, orange). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite® Plus 647 IBA1 antibody (CL647-81728, Clone: 4D5, Magenta), GFAP antibody (60190-1-Ig, Clone: 4B2E10, orange). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of mouse brain using 83448-9-RR
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite® Plus 647 IBA1 antibody (CL647-81728, Clone: 4D5, Magenta), GFAP antibody (60190-1-Ig, Clone: 4B2E10, orange). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TMEM119 antibody (83448-9-RR, Clone: 251557E2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite® Plus 647 IBA1 antibody (CL647-81728, Clone: 4D5, Magenta), GFAP antibody (60190-1-Ig, Clone: 4B2E10, orange). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
Affinity of 83448-9-RR
Biolayer interferometry (BLI) kinetic assays of 83448-9-RR against Human TMEM119 were performed. The affinity constant is 3.12 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in	Human brain cancer（Astrocitoma）, mouse brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	mouse brain tissue

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)-P	IF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83448-9-RR targets TMEM119 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1823 Product name: Recombinant human TMEM119 protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-96 aa of NM_181724 Sequence: RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM Predict reactive species
Full Name	transmembrane protein 119
Calculated Molecular Weight	29 kDa
GenBank Accession Number	NM_181724
Gene Symbol	TMEM119
Gene ID (NCBI)	338773
RRID	AB_3743479
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q4V9L6
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transmembrane protein 119 (TMEM119), was characterized to be a specific microglia marker by Bennet et al. in 2016, although its function in microglia remains unknown. It is considered to be a marker expressed by microglia under homeostatic conditions based on transcriptomic findings . Under pathological conditions, the immune-specialized brain microenvironment contains both resident microglia and bone marrow-derived myeloid cells recruited from peripheral circulation. Recently, transmembrane protein 119 (TMEM119) has been reported as a marker for resident microglia which is not expressed by bone marrow-derived myeloid cells. (PMID: 35247551, PMID: 38308250, PMID: 40373772)