Tested Applications
| Positive WB detected in | SH-SY5Y cells, SK-N-SH cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29904-1-AP targets TPH1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31623 Product name: Recombinant human TPH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 385-444 aa of BC106739 Sequence: KMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI Predict reactive species |
| Full Name | tryptophan hydroxylase 1 |
| Calculated Molecular Weight | 466 aa, 53 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC106739 |
| Gene Symbol | TPH1 |
| Gene ID (NCBI) | 7166 |
| RRID | AB_3742319 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17752 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tryptophan hydroxylase 1 (TPH1) is the rate-limiting enzyme in the synthesis of serotonin (5-HT) from the amino acid tryptophan. It is primarily found in peripheral tissues such as the gut, pineal gland, and spleen. TPH1 plays a crucial role in regulating peripheral serotonin levels, which are involved in various physiological processes including gastrointestinal motility and cardiovascular function. Additionally, TPH1 has been implicated in the regulation of blood glucose levels and is associated with conditions such as fatty liver disease. (PMID: 32590025, PMID: 36331742, PMID: 37652099)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TPH1 antibody 29904-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

