Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10699-1-AP targets SUMO2/3 in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1135 Product name: Recombinant human SUMO3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC008420 Sequence: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF Predict reactive species |
| Full Name | SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 11-20 kDa |
| GenBank Accession Number | BC008420 |
| Gene Symbol | SUMO3 |
| Gene ID (NCBI) | 6612 |
| RRID | AB_3669122 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55854 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SUMO2/3 antibody 10699-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Biochim Biophys Acta Mol Basis Dis MMP8-mediated vascular remodeling in pulmonary hypertension | ||
Am J Pathol Small Ubiquitin-Like Modifier 3 Attenuates Lung Ischemia-Reperfusion Injury Progression by Inhibiting Endoplasmic Reticulum Stress through Heat Shock Protein 70. | ||
Biochim Biophys Acta Mol Basis Dis HIF1α/PRDX1 axis drives pulmonary vascular remodeling through DRP1 DeSUMOylation and mitochondrial fragmentation. | ||
Cell Rep ESM1 SUMOylation mediates bevacizumab resistance in ovarian cancer through ITGB1-FAK-driven angiogenesis. |

