Tested Applications
| Positive WB detected in | PMA treated A549 cells |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue, human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10809-1-AP targets LIX/CXCL5 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1079 Product name: Recombinant human CXCL5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC008376 Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 5 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 10-12 kDa |
| GenBank Accession Number | BC008376 |
| Gene Symbol | CXCL5 |
| Gene ID (NCBI) | 6374 |
| RRID | AB_2292366 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42830 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chemokines are a class of pro-inflammatory cytokines that can recruit and activate chemotactic cells. CXCL5 is a member of the chemokine family binding CXCR2, a G-protein coupled receptor. CXCL5 is a chemokine that promotes tumor formation by triggering the migration of immune cells to tumors and promotes immmuno-suppressive characteristics of the tumor microenvironment. CXCL5 can also promote tumor cell metastasis and recruit vascular endothelial cells for angiogenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LIX/CXCL5 antibody 10809-1-AP | Download protocol |
| WB protocol for LIX/CXCL5 antibody 10809-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LIX/CXCL5 Polyclonal antibody (Cat# 10809-1-AP) has been cited in 3 publications. These citations appear in Advanced Science, Cancer Letters, and Stem Cells. The associated research fields include tumor microenvironment heterogeneity in pseudomyxoma peritonei, immunophenotypic profiling and neutrophil heterogeneity in colorectal cancer, and cell proliferation/immune regulation in human mesenchymal stem cells.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Single-Cell Transcriptomic Analysis of Tumor Heterogeneity and the Microenvironment in Pseudomyxoma Peritonei. | ||
Cancer Lett Distinct Immunophenotypic Profiles and Neutrophil Heterogeneity in Colorectal Cancer | ||
Stem Cells Advantages of Cell Proliferation and Immune Regulation in CD146+NESTIN+ HUMSCs: Insights from Single-Cell RNA Sequencing |
