Tested Applications
| Positive WB detected in | A549 cells, U-87 MG cells, ROS1728 cells |
| Positive IP detected in | ROS1728 cells |
| Positive IHC detected in | human breast cancer tissue, human osteosarcoma tissue, human malignant melanoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | ROS1728 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11239-1-AP targets Cathepsin K in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1761 Product name: Recombinant human CTSK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC016058 Sequence: MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM Predict reactive species |
| Full Name | cathepsin K |
| Calculated Molecular Weight | 39 kDa |
| Observed Molecular Weight | 27 kDa, 38~46 kDa |
| GenBank Accession Number | BC016058 |
| Gene Symbol | Cathepsin K |
| Gene ID (NCBI) | 1513 |
| RRID | AB_2245581 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43235 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CTSK(cathepsin K), also named CTSO, CTSO2, is a recently identified lysosomal cysteine proteinase. CTSK is synthesized as a proenzyme of 38 kDa and subsequently enters acidic lysosomal compartments, in which the propeptide is cleaved and transformed into an active enzyme and it may influence adipocyte differentiation through modifying extracellular matrix components(PMID:16912123). It is revealed both the 46-kDa cathepsin-K precursor and the 30-kDa mature form in mouse bone extracts (PMID:9811821). The high CTSK protein levels are only detected in primary cultured fibroblasts derived from normal and neoplastic breast tissue, where the 37- and 25-kDa bands to be detected correspond to pro- and mature proteins through western blot (PMID:18765527). The full length protein has a signal peptides with 15 amino acids and a propeptide with 99 amino acids. CTSK may have cross reaction with the other members of cathepsin family and form a complex of 70 kDa with an unidentified subunit(PMID:1930136).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cathepsin K antibody 11239-1-AP | Download protocol |
| IHC protocol for Cathepsin K antibody 11239-1-AP | Download protocol |
| IP protocol for Cathepsin K antibody 11239-1-AP | Download protocol |
| WB protocol for Cathepsin K antibody 11239-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Cathepsin K Polyclonal antibody (Cat# 11239-1-AP) has accumulated 149 citations. Publications appear in high-impact journals including Cell, Nature Communications, Nature Cell Biology, Bone Research, Biomaterials, Advanced Science, Cell Death & Disease, FASEB Journal, Osteoporosis International, and Arthritis & Rheumatology. Key research fields include osteoclast biology, osteoporosis, rheumatoid arthritis, periodontitis, bone metastasis, osteoarthritis, ferroptosis, and bone regeneration.
| Species | Application | Title |
|---|---|---|
Mil Med Res Propionate and butyrate attenuate macrophage pyroptosis and osteoclastogenesis induced by CoCrMo alloy particles | ||
Bioact Mater A parathyroid hormone related supramolecular peptide for multi-functionalized osteoregeneration | ||
Bone Res DNMT aberration-incurred GPX4 suppression prompts osteoblast ferroptosis and osteoporosis | ||
Bone Res SphK1/mitophagy axis in cementocytes drives orthodontic root resorption via mitochondrial transfer to osteoclasts. |
Reviews
What customers say
Users report that this antibody performs well for Western Blot detection of Cathepsin K. One reviewer noted a very clean blot with no off-target bands when used at 1:500 dilution on mouse osteoclast protein, giving it a top rating. Another reviewer, also using a 1:500 dilution on mouse tail tendon protein, found the antibody acceptable but noted that obtaining a strong signal was somewhat challenging. Overall, the antibody is considered effective for WB applications, though signal intensity may vary depending on the tissue source.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Isabel (Verified Customer) (07-03-2020) | Antibody worked really well to detect Cathepsin K in protein from mouse osteoclasts. Blot was really clean with no other bands.
 |
RICHA (Verified Customer) (10-09-2019) | Good but hard to get the signal
 |
