×
Use Able AI chat for product recommendations

Septin 10 Polyclonal antibody

Septin 10 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12420-1-AP
Publications (1)
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SEPT10, SEPTIN10, Septin-10

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of human kidney tissue using Septin 10 Polyclonal antibody (12420-1-AP)

    WB analysis of human kidney using 12420-1-AP

    human kidney tissue were subjected to SDS PAGE followed by western blot with 12420-1-AP (Septin 10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HeLa cells using Septin 10 Polyclonal antibody (12420-1-AP)

    WB analysis of HeLa using 12420-1-AP

    HeLa cells were subjected to SDS PAGE followed by western blot with 12420-1-AP (Septin 10 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human pancreas cancer tissue using Septin 10 Polyclonal antibody (12420-1-AP)

    IHC staining of human pancreas cancer using 12420-1-AP

    Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12420-1-AP (Septin 10 antibody) at dilution of 1:50 (under 10x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of mouse kidney tissue using Septin 10 Polyclonal antibody (12420-1-AP)

    IHC staining of mouse kidney using 12420-1-AP

    Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12420-1-AP (Septin 10 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of rat kidney tissue using Septin 10 Polyclonal antibody (12420-1-AP)

    IHC staining of rat kidney using 12420-1-AP

    Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 12420-1-AP (Septin 10 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human placenta tissue using Septin 10 Polyclonal antibody (12420-1-AP)

    IHC staining of human placenta using 12420-1-AP

    Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12420-1-AP (Septin 10 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of rat heart tissue using Septin 10 Polyclonal antibody (12420-1-AP)

    IHC staining of rat heart using 12420-1-AP

    Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 12420-1-AP (Septin 10 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using Septin 10 Polyclonal antibody (12420-1-AP)

    IF Staining of HepG2 using 12420-1-AP

    Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 12420-1-AP (Septin 10 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Able AI
Able AI
What's the best dilution for Septin 10 in ?

Tested Applications

Positive WB detected inhuman kidney tissue, HeLa cells
Positive IHC detected inhuman pancreas cancer tissue, human placenta tissue, rat kidney tissue, rat heart tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12420-1-AP targets Septin 10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3071

Product name: Recombinant human SEPT10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC020502

Sequence: MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGNKMVKARQYPWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEA

Predict reactive species
Full Name septin 10
Calculated Molecular Weight 53 kDa, 57 kDa
Observed Molecular Weight 53-57 kDa
GenBank Accession NumberBC020502
Gene Symbol Septin 10
Gene ID (NCBI) 151011
RRIDAB_2186992
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9P0V9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for Septin 10 antibody 12420-1-APDownload protocol
IHC protocol for Septin 10 antibody 12420-1-APDownload protocol
WB protocol for Septin 10 antibody 12420-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Septin 10 Polyclonal antibody (Cat# 12420-1-AP) has a total of 1 citation. It appears in the journal RNA (Impact Factor: 4.3), published in 2025. The cited study investigated the role of NSUN7 in sperm tail longitudinal column positioning, placing this citation within the research fields of reproductive biology and RNA metabolism. The antibody was used for Western blot in mouse samples.

Automatically generated from the 1 publication citations by Able AI.
SpeciesApplicationTitle
mouseWB

RNA

Positioning of sperm tail longitudinal columns depends on NSUN7, an RNA-binding protein destabilizing elongated spermatid transcripts.

Authors - Ekaterina A. Guseva
View Article
||
New chat

Able™

正在加载，请稍候...