MMP23B Polyclonal antibody

MMP23B Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 13020-1-AP

Publications (2)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

EC:3.4.24.-, Femalysin, matrix metallopeptidase 23B, Matrix metalloproteinase 21, Matrix metalloproteinase 22

Formulation: PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICCFC (Intra)

WB analysis of A549 using 13020-1-AP
A549 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 13020-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 13020-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 13020-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of A549 using 13020-1-AP
A549 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 13020-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 13020-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 13020-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 13020-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 13020-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 13020-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MMP23B antibody (13020-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of HepG2 using 13020-1-AP
1x10^6 HepG2 cells were intracellularly stained with 0.25 ug MMP23B Polyclonal antibody (13020-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MMP23B in ?

Overview

Tested Applications
Product Information
Publications (2)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A549 cells, HepG2 cells, mouse liver tissue, PC-3 cells
Positive IHC detected in	human ovary tumor tissue, human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells
Positive FC (Intra) detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:100-1:400
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13020-1-AP targets MMP23B in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag4113 Product name: Recombinant human MMP23B protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 52-390 aa of BC025719 Sequence: QGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG Predict reactive species
Full Name	matrix metallopeptidase 23B
Calculated Molecular Weight	390 aa, 44 kDa
Observed Molecular Weight	46-60 kDa
GenBank Accession Number	BC025719
Gene Symbol	MMP23B
Gene ID (NCBI)	8510
RRID	AB_2146152
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75900
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP23B(matrix metallopeptidase 23B) is also named as MMP21, MMP22.It is a regulator in matrix remodeling and may be playing a role in enchondral bone formation and in regulation of cranial suture closure .It has 3 isoforms produced by alternative splicing with the molecular weight of 44KDa,48KDa and 46KDa,respectively.It also can be N-glycosylated.

Publications

What published studies show

The MMP23B Polyclonal antibody (Cat# 13020-1-AP) has 2 citations. These appear in Journal of Hematology & Oncology and Current Eye Research. The cited studies span proteogenomic analysis of pancreatic ductal adenocarcinoma biology and treatment, as well as investigation of cohesin complex interactions with MMP gene promoters in pterygium occurrence. Both citations involve human samples, with applications including IHC and WB.

Species	Application	Title
human	IHC	J Hematol Oncol Proteogenomic insights into the biology and treatment of pancreatic ductal adenocarcinoma Authors - Yexin Tong View Article
human	WB,IHC	Curr Eye Res Cohesin Complex Interacting with Promoters of MMP Genes for in Pterygium Occurrence Authors - Shichao Han View Article