DVL3 Polyclonal antibody

DVL3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13444-1-AP

Publications (17)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Dishevelled 3, Segment polarity protein dishevelled homolog DVL-3, KIAA0208, DSH homolog 3, Dishevelled-3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis using 13444-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 13444-1-AP (DVL3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of MCF-7 using 13444-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 13444-1-AP (DVL3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of Raji using 13444-1-AP
IP result of anti-DVL3 (IP:13444-1-AP, 4ug; Detection:13444-1-AP 1:500) with Raji cells lysate 1440ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 13444-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 13444-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cervical cancer using 13444-1-AP
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate cancer using 13444-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cervical cancer using 13444-1-AP
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate cancer using 13444-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse colon using 13444-1-AP
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse colon using 13444-1-AP
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 13444-1-AP (DVL3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 13444-1-AP
Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using DVL3 antibody (13444-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 13444-1-AP
Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 13444-1-AP (DVL3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DVL3 in ?

Overview

Tested Applications
Product Information
Publications (17)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A549 cells, MCF-7 cells, Raji cells
Positive IP detected in	Raji cells
Positive IHC detected in	human colon cancer tissue, human prostate cancer tissue, mouse colon tissue, human cervical cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:6000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13444-1-AP targets DVL3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse, xenopus
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag4272 Product name: Recombinant human DVL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-319 aa of BC032459 Sequence: MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVL Predict reactive species
Full Name	dishevelled, dsh homolog 3 (Drosophila)
Calculated Molecular Weight	716 aa, 78 kDa
Observed Molecular Weight	78 kDa
GenBank Accession Number	BC032459
Gene Symbol	DVL3
Gene ID (NCBI)	1857
RRID	AB_2093451
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q92997
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for DVL3 antibody 13444-1-AP	Download protocol
IHC protocol for DVL3 antibody 13444-1-AP	Download protocol
IP protocol for DVL3 antibody 13444-1-AP	Download protocol
WB protocol for DVL3 antibody 13444-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The DVL3 Polyclonal antibody (Cat# 13444-1-AP) has 17 citations across journals including Advanced Science, Cancer Letters, Oncogene, Journal of Cell Biology, International Journal of Biological Sciences, Journal of Translational Medicine, Molecules, Stem Cells, Molecular Carcinogenesis, eLife, Oncotarget, and bioRxiv. Research fields span Wnt/β-catenin signaling, cardiac remodeling, tumor metastasis and EMT, multiple myeloma, endometrial fibrosis, hepatocellular carcinoma, breast cancer, bladder cancer, ciliogenesis, planar cell polarity, and axon guidance.

Species	Application	Title
mouse	WB	Adv Sci (Weinh) PNPO-Mediated Oxidation of DVL3 Promotes Multiple Myeloma Malignancy and Osteoclastogenesis by Activating the Wnt/β-Catenin Pathway Authors - Zhendong Deng View Article
		Adv Sci (Weinh) ZER1 Restrains Pressure Overload-Induced Cardiac Remodeling by Targeting DVL2 for Gly/N-Degron-Dependent Degradation. Authors - Mingchao Jiang View Article
human	WB	Cancer Lett SOX2 promotes tumor metastasis by stimulating epithelial-to-mesenchymal transition via regulation of WNT/β-catenin signal network. Authors - Li Xuefei X View Article
human	WB,IP	Int J Biol Sci CYR61 Acts as an Intracellular Microtubule-Associated Protein and Coordinates Mitotic Progression via PLK1-FBW7 Pathway Authors - Kaishun Hu View Article
	WB	J Transl Med DKK1 loss promotes endometrial fibrosis via autophagy and exosome-mediated macrophage-to-myofibroblast transition Authors - Zhanqin Zhang View Article
human	WB	Oncogene The Wnt/β-catenin/VASP positive feedback loop drives cell proliferation and migration in breast cancer. Authors - Kai Li View Article