Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14144-1-AP targets LMX1A in WB, ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5311 Product name: Recombinant human LMX1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-382 aa of BC066353 Sequence: MEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS Predict reactive species |
| Full Name | LIM homeobox transcription factor 1, alpha |
| Calculated Molecular Weight | 43 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC066353 |
| Gene Symbol | LMX1A |
| Gene ID (NCBI) | 4009 |
| RRID | AB_3085429 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TE12 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LMX1A is a transcription factor that positively regulates insulin gene transcription. LMX1A also plays a role in the development of dopamine-producing neurons during embryogenesis (PMID: 36381759). LMX1A has 2 isoforms with the molecular mass of 15 kDa (LMX1A-4AB) and 43 kDa (Isoform 1). LMX1A-4AB is expressed in testis. Isoform 1 of LMX1A is expressed in many tissues but not found in heart, liver, spleen and testis.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for LMX1A antibody 14144-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The single review rates the antibody 3 out of 5 stars for immunofluorescence at a 1:100 dilution. The user reported a weak signal when staining iPSC-derived brain organoid cryosections, suggesting the antibody may perform better on paraffin-embedded tissue or 2D cell cultures. Overall, the feedback indicates the product is functional but may not be optimal for organoid cryosection applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hariam (Verified Customer) (10-07-2025) | I had a weak signal in iPSC-derived organoid cryosections, it could work better in paraffin embedded tissue or in 2D-cell cultures.
|
