Tested Applications
| Positive WB detected in | HL-60 cells, HeLa cells, MCF-7 cells, Raji cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse colon tissue, human colon tissue, human pancreas tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14545-1-AP targets CLIC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6049 Product name: Recombinant human CLIC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-241 aa of BC064527 Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK Predict reactive species |
| Full Name | chloride intracellular channel 1 |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 27-32 kDa |
| GenBank Accession Number | BC064527 |
| Gene Symbol | CLIC1 |
| Gene ID (NCBI) | 1192 |
| RRID | AB_2081809 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00299 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chloride intracellular channel protein 1 (CLIC1) is a member of the chloride intracellular channel protein family. It plays a crucial role in various cellular processes, including the regulation of chloride ion transport, cell viability, and mitochondrial function. CLIC1 is involved in the formation of membrane-inserted channels that facilitate chloride ion movement, which is essential for maintaining cellular homeostasis and function (PMID: 32116799). Additionally, CLIC1 has been implicated in cancer progression, where it influences cell proliferation, migration, and invasion (PMID: 38027011).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CLIC1 antibody 14545-1-AP | Download protocol |
| IHC protocol for CLIC1 antibody 14545-1-AP | Download protocol |
| IP protocol for CLIC1 antibody 14545-1-AP | Download protocol |
| WB protocol for CLIC1 antibody 14545-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CLIC1 antibody (Cat# 14545-1-AP) has 14 citations published in journals including Nature Communications, Phytomedicine, Alzheimer's Research & Therapy, Biochemical Pharmacology, Translational Oncology, Frontiers in Oncology, PLoS One, and Advanced Science. Research fields span NLRP3 inflammasome activation, Alzheimer's disease, ferroptosis, hepatocellular carcinoma, esophageal cancer, breast cancer, bladder cancer, lung adenocarcinoma, diabetic cardiomyopathy, cellular senescence, angiogenesis, and neuropathic pain.
| Species | Application | Title |
|---|---|---|
Nat Commun CLICs-dependent chloride efflux is an essential and proximal upstream event for NLRP3 inflammasome activation. | ||
Phytomedicine Benzoylmesaconine mitigates NLRP3 inflammasome-related diseases by reducing intracellular K+ efflux and disrupting NLRP3 inflammasome assembly | ||
Alzheimers Res Ther Circular RNA APP contributes to Alzheimer's disease pathogenesis by modulating microglial polarization via miR-1906/CLIC1 axis | ||
Oxid Med Cell Longev Attenuation of ROS/Chloride Efflux-Mediated NLRP3 Inflammasome Activation Contributes to Alleviation of Diabetic Cardiomyopathy in Rats after Sleeve Gastrectomy. | ||
Biochem Pharmacol Identification of CLIC1 as a direct molecular target of luteolin associated with ferroptosis induction in hepatocellular carcinoma. | ||
Immune Netw Extracellular Acidification Augments NLRP3-Mediated Inflammasome Signaling in Macrophages |
