Tested Applications
| Positive WB detected in | HepG2 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15321-1-AP targets PAM16 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0970 Product name: Recombinant human PAM16 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC005024 Sequence: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERP Predict reactive species |
| Full Name | mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC005024 |
| Gene Symbol | PAM16 |
| Gene ID (NCBI) | 51025 |
| RRID | AB_2878126 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y3D7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PAM16, also named as Magmas, TIM16 and TIMM16, is regulates ATP-dependent protein translocation into the mitochondrial matrix. The MW of PAM16 is about 14-16 kDa in WB detection. PAM16 is a component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16/PAM16 and TIMM14/DNAJC19.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PAM16 antibody 15321-1-AP | Download protocol |
| WB protocol for PAM16 antibody 15321-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PAM16 polyclonal antibody (catalog number 15321-1-AP) has 6 total citations. These appear in journals including Nature Communications, Redox Biology, EMBO Journal, Cancer Research Communications, Journal of Neuro-Oncology, and bioRxiv. The associated research fields focus on mitochondrial biology, particularly mitophagy and the PINK1-Parkin pathway, as well as mitochondrial protein import, copper accumulation, and Alzheimer's disease pathology. Additional citations address MAGMAS inhibition in glioblastoma and malignant glioma treatment. Applications cited include Western blot and immunohistochemistry.
| Species | Application | Title |
|---|---|---|
Nat Commun Protein import motor complex reacts to mitochondrial misfolding by reducing protein import and activating mitophagy | ||
Redox Biol Lead aggravates Alzheimer's disease pathology via mitochondrial copper accumulation regulated by COX17 | ||
EMBO J A unified mechanism for mitochondrial damage sensing in PINK1-Parkin-mediated mitophagy. | ||
Cancer Res Commun MAGMAS Inhibition Enhances Temozolomide Efficacy in Chemotherapy-Resistant Glioblastoma Models.
| ||
bioRxiv Novel reporter of the PINK1-Parkin mitophagy pathway identifies its damage sensor in the import gate |
