Tested Applications
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15333-1-AP targets SEPX1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7391 Product name: Recombinant human SEPX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC003127 Sequence: MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQG Predict reactive species |
| Full Name | selenoprotein X, 1 |
| Calculated Molecular Weight | 13 kDa |
| GenBank Accession Number | BC003127 |
| Gene Symbol | SEPX1 |
| Gene ID (NCBI) | 51734 |
| RRID | AB_2878127 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZV6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SEPX1 antibody 15333-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SEPX1 Polyclonal antibody (Cat# 15333-1-AP) has 5 citations across journals including Nature Cell Biology, Nature Chemical Biology, Advanced Science, Free Radical Biology and Medicine, and Journal of Cardiovascular Translational Research. Research fields span ferroptosis vulnerability via selenoprotein translation, hepatic lipid metabolism and steatohepatitis protection, oxidative stress resistance through methionine sulfoxide reductases, and exosome-mediated prevention of vascular restenosis. Applications cited include WB and IHC in human, mouse, and rat samples.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Targeting oncogenic FLT3 uncovers a ferroptosis vulnerability through selenocysteine recoding in acute myeloid leukaemia | ||
Nat Chem Biol Ribosome stalling during selenoprotein translation exposes a ferroptosis vulnerability. | ||
Adv Sci (Weinh) Selenoprotein H Functions as a PPARα Coactivator to Link Selenium Homeostasis to Hepatic Lipid Metabolism and Protect against Steatohepatitis. | ||
Free Radic Biol Med Loss of methionine sulfoxide reductases increases resistance to oxidative stress. | ||
J Cardiovasc Transl Res Exosomes Derived from AT2R-Overexpressing BMSC Prevent Restenosis After Carotid Artery Injury by Attenuating the Injury-Induced Neointimal Hyperplasia. |
