Tested Applications
| Positive WB detected in | rat heart tissue, human colon tissue, human testis tissue, mouse heart tissue, mouse testis tissue, HEK-293 cells, A549 cells |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human colon cancer tissue, mouse colon tissue, mouse cerebellum tissue, rat skin tissue, human breast cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15346-1-AP targets CKMT1A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, sus scrofa domesticus (domestic pig) |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7583 Product name: Recombinant human CKMT1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 41-417 aa of BC001926 Sequence: SERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH Predict reactive species |
| Full Name | creatine kinase, mitochondrial 1A |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | BC001926 |
| Gene Symbol | CKMT1A |
| Gene ID (NCBI) | 548596 |
| RRID | AB_2081073 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P12532 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CKMT1A(Creatine kinase U-type, mitochondrial) is also named CKMT and belongs to the ATP:guanido phosphotransferase family. CKMT1A is a nearly identical copy of the CKMT1B gene. Both genes encode an identical CKMT1 protein(PMID:17098888). It reversibly catalyzes the transfer of phosphate between ATP and various phosphates. It has 2 isoforms produced by alternative splicing with the molecular weight of 47 kDa and 50 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CKMT1A antibody 15346-1-AP | Download protocol |
| IP protocol for CKMT1A antibody 15346-1-AP | Download protocol |
| WB protocol for CKMT1A antibody 15346-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CKMT1A polyclonal antibody (Cat# 15346-1-AP) has 24 citations. These appear in journals including Cell Metabolism, Nature Communications, Advanced Science, Cell Reports, EMBO Journal, Journal of Biological Chemistry, Molecular Oncology, International Journal of Cancer, Investigative Ophthalmology & Visual Science, and Biochimica et Biophysica Acta. Research fields span cancer biology, energy/creatine metabolism, neurobiology, bone remodeling, and mitochondrial function, with applications in WB, IHC, and IF across human, mouse, rat, and pig.
| Species | Application | Title |
|---|---|---|
Cell Metab Tyrosine Phosphorylation of Mitochondrial Creatine Kinase 1 Enhances a Druggable Tumor Energy Shuttle Pathway.
| ||
Nat Commun Functional antagonism between ΔNp63α and GCM1 regulates human trophoblast stemness and differentiation.
| ||
Adv Sci (Weinh) CKB Promotes Mitochondrial ATP Production by Suppressing Permeability Transition Pore | ||
Adv Healthc Mater Phyhip-Targeted Delivery of bFGF Platform with Dual Modulation for Enhancing Neurovascular Repair in Traumatic Brain Injury. | ||
BMC Med MTHFD2 promotes osteoclastogenesis and bone loss in rheumatoid arthritis by enhancing CKMT1-mediated oxidative phosphorylation | ||
Reviews
What customers say
The single review for this product is highly positive (5/5). The reviewer used the antibody at a 1:500 dilution on a porcine HCC cell line for Western Blot and reported a strong, prominent band at approximately 42 kD. They noted the antibody performs superbly and also works well at a 1:1000 dilution, indicating good sensitivity and flexibility in usage.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nusrat (Verified Customer) (08-09-2024) | The antibody yielded a strong, prominent band at about 42 kD and works superbly. It also works well at a 1:1000 dilution.
|
