Tested Applications
| Positive WB detected in | mouse brain tissue, A375 cells, Jurkat cells, mouse lung tissue, rat brain tissue |
| Positive IP detected in | A375 cells |
| Positive IF/ICC detected in | A375 cells, HepG2 cells |
| Positive FC (Intra) detected in | A375 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16534-1-AP targets CTHRC1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9812 Product name: Recombinant human CTHRC1 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-243 aa of BC014245 Sequence: MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK Predict reactive species |
| Full Name | collagen triple helix repeat containing 1 |
| Calculated Molecular Weight | 243 aa, 26 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC014245 |
| Gene Symbol | CTHRC1 |
| Gene ID (NCBI) | 115908 |
| RRID | AB_2087511 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96CG8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Collagen triple helix repeat-containing protein 1 (CTHRC1), also known as protein NMTC1, is a glycosylated secreted protein. CTHRC1 was identified as a novel molecular in injured and diseased arteries where it may contribute to vascular remodeling by limiting collagen matrix deposition and promoting cell migration (PMID: 15618538). It has been reported that CTHRC1 is a positive regulator of osteoblastic bone formation (PMID: 18779865). Besides, studies reveal that CTHRC1 expression is implicated in various malignancies, including hepatocellular carcinoma, gastric carcinoma, colon cancer, and lung cancer (PMID: 23922981; 24504172; 24746208; 25139095).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CTHRC1 antibody 16534-1-AP | Download protocol |
| IF protocol for CTHRC1 antibody 16534-1-AP | Download protocol |
| IP protocol for CTHRC1 antibody 16534-1-AP | Download protocol |
| WB protocol for CTHRC1 antibody 16534-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CTHRC1 antibody (catalog no. 16534-1-AP) has 43 citations. These appear in journals including Cell, Cancer Research, EBioMedicine, Oncogene, JCI Insight, Theranostics, Int J Biol Sci, Cell Signaling, and J Cell Sci, among others. Research fields span pulmonary and tissue fibrosis, cancer (colorectal, gastric, ovarian, prostate, glioma, melanoma, HNSCC), epithelial-mesenchymal transition, tumor microenvironment/fibroblasts, metastasis, and related signaling pathways, validated mainly by WB, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Cell Deep-learning-based de novo discovery and design of therapeutics that reverse disease-associated transcriptional phenotypes. | ||
Cancer Res Cancer-Associated Fibroblasts Expressing Sulfatase 1 Facilitate VEGFA-Dependent Microenvironmental Remodeling to Support Colorectal Cancer | ||
J Adv Res Elevated lactate production exacerbates PM2.5-induced pulmonary fibrosis by stabilizing TGF-β1 | ||
Theranostics Single-cell landscape reveals active cell subtypes and their interaction in the tumor microenvironment of gastric cancer. | ||
Int J Biol Sci NEDD4L-induced β-catenin ubiquitination suppresses the formation and progression of interstitial pulmonary fibrosis via inhibiting the CTHRC1/HIF-1α axis. | ||
Cell Commun Signal Senescent fibroblasts secrete CTHRC1 to promote cancer stemness in hepatocellular carcinoma. |
Reviews
What customers say
Both reviews rate the antibody 5 stars. One user reports a clear 28/30 kDa band in Western blot at 1:1000 dilution on human and murine lung fibroblasts with no background. The other user successfully used it at 1:200 for immunofluorescence on human skeletal muscle sections, employing a methanol permeabilization protocol and Alexa 488-conjugated secondary antibody. Overall, customers are highly satisfied with the antibody's specificity and performance across applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Swati (Verified Customer) (09-26-2025) | The antibody shows a clear band at 28/30 kDa in WB with no background. Excellent.
 |
Valeria (Verified Customer) (11-11-2020) | Fixative: 4% paraformaldehydeAntigen retrieval step: NoPermeabilization: Methanol gradient (70% for 10 mins, 95% for 10 mins, 100% for 20 mins, 95% for 10 mins, 70% for 10 mins)Protein blocking: 10% NGS diluted in TBSTEndogenous biotin blocking: Avidin D solution for 15 mins, Biotin for 15 mins (Vector Laboratories, Inc)Secondary antibody: Life tech/ThermoFisher, A11006, Alexa 488, Goat anti-Rabbit isotype IgG, 1:100
 |
