Use Able AI chat for product recommendations

MED31 Polyclonal antibody

MED31 Polyclonal Antibody for WB, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

SOH1, Mediator of RNA polymerase II transcription subunit 31, hSOH1, CGI-125

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MED31 in ?

Tested Applications

Positive WB detected inmouse testis tissue, human brain tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16590-1-AP targets MED31 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9008

Product name: Recombinant human MED31 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-131 aa of BC012539

Sequence: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK

Predict reactive species
Full Name mediator complex subunit 31
Calculated Molecular Weight 131 aa, 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC012539
Gene Symbol MED31
Gene ID (NCBI) 51003
RRIDAB_2142447
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y3C7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MED31, also named as SOH1 or CGI-125, is a 131 amino acid protein, which belongs to the Mediator complex subunit 31 family. MED31 localizes in the nucleus. MED31 as a component of the Mediator complex, a coactivator is involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. MED31 functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery.

Protocols

Product Specific Protocols
IF protocol for MED31 antibody 16590-1-APDownload protocol
WB protocol for MED31 antibody 16590-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The MED31 Polyclonal antibody (Cat# 16590-1-AP) has 1 total citation. It was published in Developmental Biology (2010), in a study investigating the role of the Mediator complex protein Med31 in embryonic growth and cell proliferation during mammalian development. The research field is developmental biology, specifically focusing on transcriptional regulation and embryogenesis. The cited application was Western Blot in mouse.

SpeciesApplicationTitle
mouseWB

Dev Biol

The Mediator complex protein Med31 is required for embryonic growth and cell proliferation during mammalian development.

Authors - Risley Michael D MD

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers gave this antibody a 5-star rating for Western Blot. One user tested it at 1:500 dilution on mouse cardiomyocytes and reported very clear bands. Another user tested it at 1:1000 dilution on mouse heart tissue and described the result as a good band. Both reviews were from the same lot (00007933) and were posted in 2021. Overall, users are satisfied with the specificity and signal quality of this antibody in WB applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Anh (Verified Customer) (07-15-2021)

very clear bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: mouse cardiomyocytes

siting (Verified Customer) (02-17-2021)

good band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse heart
MED31 Antibody Western Blot validation (1:1000 dilution) in mouse heart (Cat no:16590-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...