Use Able AI chat for product recommendations

LAG-3/CD223 Polyclonal antibody

LAG-3/CD223 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 16616-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

CD223, LAG3, FDC, LAG 3, LAG-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPHA treated human PBMCs
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16616-1-AP targets LAG-3/CD223 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9909

Product name: Recombinant human LAG3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-360 aa of BC052589

Sequence: AEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE

Predict reactive species
Full Name lymphocyte-activation gene 3
Calculated Molecular Weight 525 aa, 57 kDa
Observed Molecular Weight60-70 kDa
GenBank Accession NumberBC052589
Gene Symbol LAG-3
Gene ID (NCBI) 3902
RRIDAB_2133350
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP18627
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LAG-3, also known as CD223, is an immune checkpoint molecule that regulates both T-cell activation and homeostasis. LAG-3 is expressed on activated T cells, NK cells, regulatory T cells, and plasmacytoid dendritic cells. It is a CD4-related molecule that binds MHC class II. LAG-3 plays an important role in modulating T cell expansion and function, and blockade of LAG-3 with monoclonal antibodies can augment T cell function. (PMID: 15634887; 21086108; 28783703)

Protocols

Product Specific Protocols
IF protocol for LAG-3/CD223 antibody 16616-1-APDownload protocol
IHC protocol for LAG-3/CD223 antibody 16616-1-APDownload protocol
IP protocol for LAG-3/CD223 antibody 16616-1-APDownload protocol
WB protocol for LAG-3/CD223 antibody 16616-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Cancer Immunol Immunother

Novel roles of VAT1 expression in the immunosuppressive action of diffuse gliomas.

Authors - Pei Yang
humanIHC

Ann Transl Med

Single-cell RNA-seq reveals transcriptional landscape and intratumor heterogenicity in gallbladder cancer liver metastasis microenvironment.

Authors - Yigang Zhang
humanWB

Cell Death Dis

Helicobacter pylori CagA promotes gastric cancer immune escape by upregulating SQLE

Authors - Sifan Liu
mouseWB

Mol Cancer

Targeting BATF2-RGS2 axis reduces T-cell exhaustion and restores anti-tumor immunity

Authors - Xuyu Gu
rat

Cancer Cell

Identification of cycling regulatory T cell precursors as conductors of immune escape during breast carcinoma progression.

Authors - Triet Minh Bui
humanIHC

Front Oncol

The immune checkpoint expression in the tumor immune microenvironment of DLBCL: Clinicopathologic features and prognosis

Authors - Jiajia Ma

Reviews

    4.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sofia (Verified Customer) (05-27-2025)

Antibody did not work as expected even using the suggested antigen retrieval. I'll try it again using a different antigen retrieval.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Brain samples

Eman (Verified Customer) (09-20-2021)

the antibody works very well for WB the recommended dilution is 1:500 to 1:1000 i think we can even dilute it more this antibody is higly recommended

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 overnight
  • Cell Tissue Type: HEK293T cells
LAG-3/CD223 Antibody Western Blot validation (1:1000 overnight dilution) in HEK293T cells (Cat no:16616-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...