Featured Product
KD/KO Validated

METTL7A Polyclonal antibody

METTL7A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17092-1-AP

Publications(3)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

AAM B, EC:2.1.1.348, EC:2.1.1.9, methyltransferase like 7A, Methyltransferase-like protein 7A

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 17092-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 17092-1-AP (METTL7A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 17092-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 17092-1-AP (METTL7A antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 17092-1-AP
WB result of METTL7A antibody (17092-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-METTL7A transfected HepG2 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 17092-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 17092-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 17092-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 17092-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human thyroid cancer using 17092-1-AP
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human thyroid cancer using 17092-1-AP
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human thyroid cancer using 17092-1-AP
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human thyroid cancer using 17092-1-AP
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (3)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HepG2 cells, HeLa cells, mouse lung tissue, rat lung tissue, mouse liver tissue
Positive IHC detected in	human liver tissue, human thyroid cancer tissue, human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunohistochemistry (IHC)	IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17092-1-AP targets METTL7A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag10013 Product name: Recombinant human METTL7A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC008180 Sequence: MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK Predict reactive species
Full Name	methyltransferase like 7A
Calculated Molecular Weight	28 kDa
Observed Molecular Weight	25-28 kDa
GenBank Accession Number	BC008180
Gene Symbol	METTL7A
Gene ID (NCBI)	25840
RRID	AB_2878348
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H8H3
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for METTL7A antibody 17092-1-AP	Download protocol
WB protocol for METTL7A antibody 17092-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Commun Biol PiR48444 inhibits MSC osteogenic differentiation and bone regeneration via targeting METTL7A/eIF4E-mediated BMP2 m6A methylation. Authors - Zhichao Zheng View Article
		Adv Sci (Weinh) METTL7A Downregulation Drives SLC1A5-Mediated Glutamine Competition to Promote Tumor Proliferation and Suppress CD8(+) T Cell Immunity in Gastric Cancer. Authors - Mingjun Sun View Article
human	IF	bioRxiv Mechanosensitive Endothelial METTL7A Regulates Internal m 7 G mRNA Methylation and Protects Against Atherosclerosis Authors - Tzu-Pin Shentu View Article