METTL7A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• METTL7A Polyclonal antibody, PBS Only (17092-1-PBS)

• Featured Product
• KD/KO Validated

METTL7A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17092-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

AAM B, EC:2.1.1.348, EC:2.1.1.9, methyltransferase like 7A, Methyltransferase-like protein 7A

• 

  WB analysis using 17092-1-AP (same clone as 17092-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17092-1-AP (METTL7A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 17092-1-AP (same clone as 17092-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17092-1-AP (METTL7A antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 17092-1-AP (same clone as 17092-1-PBS)

  WB result of METTL7A antibody (17092-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-METTL7A transfected HepG2 cells. This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 17092-1-AP (same clone as 17092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 17092-1-AP (same clone as 17092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17092-1-AP (same clone as 17092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17092-1-AP (same clone as 17092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 17092-1-AP (same clone as 17092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 17092-1-AP (same clone as 17092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 17092-1-AP (same clone as 17092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 17092-1-AP (same clone as 17092-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 17092-1-AP (METTL7A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17092-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

17092-1-PBS targets METTL7A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10013

  Product name: Recombinant human METTL7A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC008180

  Sequence: MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK

• Full Name: methyltransferase like 7A
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC008180
• Gene Symbol: METTL7A
• Gene ID (NCBI): 25840
• RRID: AB_2878348
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H8H3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.