Tested Applications
| Positive WB detected in | A431 cells |
| Positive IHC detected in | human skin cancer tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17361-1-AP targets LY6D in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10714 Product name: Recombinant human LY6D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC031330 Sequence: MRTALLLLATLAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPT Predict reactive species |
| Full Name | lymphocyte antigen 6 complex, locus D |
| Calculated Molecular Weight | 128 aa, 13 kDa |
| Observed Molecular Weight | 13-14 kDa |
| GenBank Accession Number | BC031330 |
| Gene Symbol | LY6D |
| Gene ID (NCBI) | 8581 |
| RRID | AB_2878397 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14210 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LY6D, also named as E48 and ThB, may act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. It marks the earliest stage of B-cell specification.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LY6D antibody 17361-1-AP | Download protocol |
| WB protocol for LY6D antibody 17361-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LY6D Polyclonal antibody (catalog 17361-1-AP) has 14 citations. They appear in journals including Cell Stem Cell, Nature Communications, Cell Reports, Genome Medicine, Diabetes, Cell Biosciences, International Journal of Obesity, Cancers, Human Cell, PLoS ONE, Technology in Cancer Research & Treatment, and eLife. Research fields span cancer (basal cell carcinoma, prostate, lung, breast), liver steatosis/NASH, B-cell development and immunity, and corneal aging.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Single-Cell Analysis of the Liver Epithelium Reveals Dynamic Heterogeneity and an Essential Role for YAP in Homeostasis and Regeneration. | ||
Nat Commun AP-1 and TGFß cooperativity drives non-canonical Hedgehog signaling in resistant basal cell carcinoma. | ||
Genome Med Spatiotemporal single-cell analysis elucidates the cellular and molecular dynamics of human cornea aging | ||
Reviews
What customers say
The single review for this product reports a 2-star rating for Western Blot at a 1/1000 dilution. The user tested it on liver protein extract and found the antibody did not perform as expected, producing unspecific bands above 130 kDa rather than a clean, specific signal. Overall, the feedback is negative, indicating the antibody failed to deliver reliable results in this particular application and sample type.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
James (Verified Customer) (05-23-2025) | This antibody did not work for my samples (liver protein extract). It gave unspecific bands over 130 kDa
 |
