LY6D Polyclonal antibody, PBS Only

• 

  WB analysis of A431 using 17361-1-AP (same clone as 17361-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 17361-1-AP (LY6D antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17361-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 17361-1-AP (same clone as 17361-1-PBS)

  WB result of LY6D antibody (17361-1-AP; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-LY6D transfected A431 cells. This data was developed using the same antibody clone with 17361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 17361-1-AP (same clone as 17361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17361-1-AP (LY6D antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 17361-1-AP (same clone as 17361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17361-1-AP (LY6D Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 17361-1-AP (same clone as 17361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17361-1-AP (LY6D Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 17361-1-AP (same clone as 17361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 17361-1-AP (LY6D antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 17361-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 17361-1-AP (same clone as 17361-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 17361-1-AP (LY6D antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 17361-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LY6D Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17361-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

E48, E48 antigen, Ly 6D, Ly-6D, Lymphocyte antigen 6D

---

Product Information

17361-1-PBS targets LY6D in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10714

  Product name: Recombinant human LY6D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC031330

  Sequence: MRTALLLLATLAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPT

• Full Name: lymphocyte antigen 6 complex, locus D
• Calculated Molecular Weight: 128 aa, 13 kDa
• Observed Molecular Weight: 13-14 kDa
• GenBank Accession Number: BC031330
• Gene Symbol: LY6D
• Gene ID (NCBI): 8581
• RRID: AB_2878397
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14210
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LY6D, also named as E48 and ThB, may act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. It marks the earliest stage of B-cell specification.