Tested Applications
| Positive WB detected in | A172 cells, HeLa cells, HepG2 cells, U-118 MG cells, U-251 cells, U-87 MG cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20171-1-AP targets GLS2 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14003 Product name: Recombinant human GLS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC059370 Sequence: MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDQ Predict reactive species |
| Full Name | glutaminase 2 (liver, mitochondrial) |
| Calculated Molecular Weight | 602 aa, 66 kDa |
| Observed Molecular Weight | 66-70 kDa |
| GenBank Accession Number | BC059370 |
| Gene Symbol | GLS2 |
| Gene ID (NCBI) | 27165 |
| RRID | AB_3085600 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UI32 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GLS2, also named as GA and GLS, belongs to the glutaminase family. It is Glutaminase liver isoform . GLS2 plays an important role in the regulation of glutamine catabolism. It promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. GLS2 may play a role in preventing tumor proliferation. This antibody is specific to GLS2.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GLS2 antibody 20171-1-AP | Download protocol |
| WB protocol for GLS2 antibody 20171-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GLS2 Polyclonal antibody (Cat# 20171-1-AP) has 4 total citations. These appear in Metabolism, Redox Biology, Molecular Cell, and Journal of Nanobiotechnology. The associated research fields include glutamine metabolism, vascular restenosis, redox biology and metabolic reprogramming, mitochondrial function in cancer, and nanotechnology-based tissue engineering for intervertebral disc degeneration. All citations used the antibody for Western blot (WB) applications.
| Species | Application | Title |
|---|---|---|
Metabolism ALDH2 deficiency aggravates vascular injury-induced restenosis by enhancing vascular smooth muscle cell proliferation through SLC38A2-mediated upregulation of glutamine uptake. | ||
Redox Biol Impaired xCT-mediated cystine uptake drives serine and proline metabolic reprogramming and mitochondrial fission in skeletal muscle cells. | ||
Mol Cell Mitochondrial glutamine import sustains electron transport chain integrity independently of glutaminolysis in cancer.
| ||
J Nanobiotechnology Synergistic microenvironment therapy: a dual-function nanogel of supramolecular collagen ll-mimetic matrix and antioxidant MXene for attenuating intervertebral disc degeneration. |
