Tested Applications
| Positive IHC detected in | human testis tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20308-1-AP targets ELOVL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14143 Product name: Recombinant human ELOVL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 77-185 aa of BC050278 Sequence: LLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYS Predict reactive species |
| Full Name | elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2 |
| Calculated Molecular Weight | 296 aa, 35 kDa |
| GenBank Accession Number | BC050278 |
| Gene Symbol | ELOVL2 |
| Gene ID (NCBI) | 54898 |
| RRID | AB_10666201 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NXB9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ELOVL2 antibody 20308-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ELOVL2 Polyclonal antibody (catalog number 20308-1-AP) has 4 total citations. These appear in Cancer Letters, Frontiers in Immunology, Cancer Metabolism, and Frontiers in Cell and Developmental Biology. The associated research fields span pancreatic ductal adenocarcinoma, retroperitoneal liposarcoma lipid metabolism, endometrial cancer cholesterol biosynthesis, and prostate cancer enzalutamide resistance, with applications in IHC and WB.
| Species | Application | Title |
|---|---|---|
Cancer Lett RCC1 regulation of subcellular protein localization via Ran GTPase drives pancreatic ductal adenocarcinoma growth | ||
Front Immunol Insight of a lipid metabolism prognostic model to identify immune landscape and potential target for retroperitoneal liposarcoma | ||
Cancer Metab POU2F1 drives cholesterol biosynthesis and lipid remodeling through the DHCR24/ELOVL2 axis in endometrial cancer.
| ||
Front Cell Dev Biol ELOVL2 mediated stabilization of AR contributes to enzalutamide resistance in prostate cancer |
