Tested Applications
| Positive WB detected in | mouse liver tissue, rat liver tissue |
| Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20588-1-AP targets FAM3A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14343 Product name: Recombinant human FAM3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-197 aa of BC002934 Sequence: GRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPLHEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPF Predict reactive species |
| Full Name | family with sequence similarity 3, member A |
| Calculated Molecular Weight | 230 aa, 25 kDa |
| Observed Molecular Weight | 25-27 kDa |
| GenBank Accession Number | BC002934 |
| Gene Symbol | FAM3A |
| Gene ID (NCBI) | 60343 |
| RRID | AB_2878704 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P98173 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FAM3A antibody 20588-1-AP | Download protocol |
| WB protocol for FAM3A antibody 20588-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FAM3A Polyclonal antibody (Cat# 20588-1-AP) has a total of 3 citations. These appear in Neural Regen Res and In Vitro Cell Dev Biol Anim. The research fields include neuronal apoptosis in acute ischemic stroke involving circular RNA regulation, phenotypic switching of human aortic smooth muscle cells via the PI3K-AKT pathway, and diabetic endothelial progenitor cell angiogenesis through the AMPK/KLF4/FAM3A pathway.
| Species | Application | Title |
|---|---|---|
Neural Regen Res The circular RNA Rap1b promotes Hoxa5 transcription by recruiting Kat7 and leading to increased Fam3a expression, which inhibits neuronal apoptosis in acute ischemic stroke | ||
In Vitro Cell Dev Biol Anim FAM3A mediates the phenotypic switch of human aortic smooth muscle cells stimulated with oxidised low-density lipoprotein by influencing the PI3K-AKT pathway
| ||
In Vitro Cell Dev Biol Anim Ferulic acid liposomes improve diabetic EPC angiogenesis by upregulating the AMPK/KLF4/FAM3A pathway. |
