Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, human brain tissue, mouse brain tissue |
| Positive IHC detected in | human kidney tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20605-1-AP targets HECTD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14581 Product name: Recombinant human HECTD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 29-121 aa of BC006237 Sequence: PGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN Predict reactive species |
| Full Name | HECT domain containing 1 |
| Calculated Molecular Weight | 2612 aa, 290 kDa |
| Observed Molecular Weight | 290 kDa |
| GenBank Accession Number | BC006237 |
| Gene Symbol | HECTD1 |
| Gene ID (NCBI) | 25831 |
| RRID | AB_10732804 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9ULT8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HECTD1 (E3 ubiquitin-protein ligase), which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates,may be required for development of the head mesenchyme and neural tube closure.It is also involved in sporadic Parkinson's disease(PMID:16714300).This protein is specific to HECTD1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HECTD1 antibody 20605-1-AP | Download protocol |
| IHC protocol for HECTD1 antibody 20605-1-AP | Download protocol |
| WB protocol for HECTD1 antibody 20605-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HECTD1 antibody (Cat# 20605-1-AP) has 12 citations across journals including Nature Communications, Molecular Cell, Cell Death & Disease, Journal of Neuroscience, Scientific Reports, Cell Signaling, Cell Biosciences, Biological Research, Human Cell, Brain Behavior, and Cellular Microbiology. Research fields span drug proteomics, estrogen receptor signaling, myocardial infarction, neuroinflammation, neuropathic pain, tumor suppressor regulation, renal fibrosis, ischemic stroke, synucleinopathies, esophageal cancer, and bacterial infection.
| Species | Application | Title |
|---|---|---|
Nat Commun Proteome-wide ligandability maps of drugs with diverse cysteine-reactive chemotypes | ||
Mol Cell Condensin I and II Complexes License Full Estrogen Receptor α-Dependent Enhancer Activation. | ||
Cell Death Dis Legumain is a predictor of all-cause mortality and potential therapeutic target in acute myocardial infarction. | ||
Cell Biosci Involvement of HECTD1 in LPS-induced astrocyte activation via σ-1R-JNK/p38-FOXJ2 axis.
| ||
Biol Res Dorsal root ganglion-derived exosomes deteriorate neuropathic pain by activating microglia via the microRNA-16-5p/HECTD1/HSP90 axis | ||
Sci Rep Proteasomal turnover of the RhoGAP tumor suppressor DLC1 is regulated by HECTD1 and USP7.
|
Reviews
What customers say
The single review for this product is highly positive, with a 5-star rating. The reviewer used it for Western Blot and Immunoprecipitation and described the product as excellent, strongly recommending it to others. Overall, the feedback reflects high satisfaction with the antibody's performance in these applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nick (Verified Customer) (04-20-2022) | Excellent stuff. Highly recommend.
|
