Tested Applications
| Positive WB detected in | RAW 264.7 cells, RAW264.7 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21568-1-AP targets SLC25A25 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16086 Product name: Recombinant human SLC25A25 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC103933 Sequence: MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQ Predict reactive species |
| Full Name | solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 |
| Calculated Molecular Weight | 469 aa, 53 kDa |
| Observed Molecular Weight | 50 kDa, 100 kDa |
| GenBank Accession Number | BC103933 |
| Gene Symbol | SLC25A25 |
| Gene ID (NCBI) | 114789 |
| RRID | AB_10858638 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6KCM7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC25A25 antibody 21568-1-AP | Download protocol |
| WB protocol for SLC25A25 antibody 21568-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC25A25 Polyclonal antibody (Cat# 21568-1-AP) has 2 total citations. These appear in two journals: Proceedings of the National Academy of Sciences of the United States of America (PNAS, IF 9.5) and the Journal of Biological Chemistry (JBC, IF 4.1). The associated research fields include metabolic regulation—specifically PGC-1α-binding RNAs and glucagon metabolic action—and ferroptosis, involving mitochondrial Zn²⁺ accumulation via the STING1-CAV2 pathway. Both citations used the antibody for Western blot (WB) applications, in mouse and human samples respectively.
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A Transcriptome-wide analysis of PGC-1α-binding RNAs identifies genes linked to glucagon metabolic action. | ||
J Biol Chem Ciprofloxacin enhances RSL3-induced ferroptosis by promoting mitochondrial Zn(2+) accumulation via the STING1-CAV2 pathway.
|
