APC1 Polyclonal antibody

APC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21748-1-AP

Publications (8)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

ANAPC1, Anaphase-promoting complex subunit 1, Apc 1, Mitotic checkpoint regulator, Testis-specific gene 24 protein

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of HeLa using 21748-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 21748-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 21748-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of K-562 using 21748-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Transfected HEK-293 using 21748-1-AP
Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (ANAPC1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cervical cancer using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 21748-1-AP (APC1 antibody) at dilution of 1:100 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cervical cancer using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded human cervical cancer using 21748-1-AP (APC1 antibody) at dilution of 1:100 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach using 21748-1-AP (APC1 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach using 21748-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach using 21748-1-AP (APC1 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for APC1 in ?

Overview

Tested Applications
Product Information
Publications (8)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	MCF-7 cells, HeLa cells, K-562 cells, Transfected HEK-293 cells, HT-1080 cells, MDA-MB-231 cells
Positive IHC detected in	mouse testis tissue, rat stomach tissue, mouse stomach tissue, human stomach cancer tissue, rat kidney tissue, human cervical cancer tissue, human stomach tissue, mouse kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21748-1-AP targets APC1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag13399 Product name: Recombinant human ANAPC1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1596-1944 aa of BC104902 Sequence: STDNRYHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM Predict reactive species
Full Name	anaphase promoting complex subunit 1
Calculated Molecular Weight	1944 aa, 217 kDa
Observed Molecular Weight	200-210 kDa
GenBank Accession Number	BC104902
Gene Symbol	APC1
Gene ID (NCBI)	64682
RRID	AB_10733241
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H1A4
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for APC1 antibody 21748-1-AP	Download protocol
WB protocol for APC1 antibody 21748-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The APC1 Polyclonal antibody (Cat# 21748-1-AP) has 8 total citations. These appear in journals including Nature Communications, Cell Reports, Cell Biosciences, Oncotarget, Scientific Reports, PLoS Pathogens, Cancer Control, and bioRxiv. Research fields span DNA replication initiation, cancer genome evolution, oocyte mRNA homeostasis, castration-resistant prostate cancer, genomic stability regulation, viral cell cycle control, colorectal cancer, and Alzheimer's disease.

Species	Application	Title
human	WB	Nat Commun DNA replication initiation factor RECQ4 possesses a role in antagonizing DNA replication initiation Authors - Xiaohua Xu View Article
human	WB	Cell Rep TRPS1 drives heterochromatic origin refiring and cancer genome evolution. Authors - Jianguo Yang View Article
human	WB	Cell Biosci PATL2 mutations affect human oocyte maternal mRNA homeostasis and protein interactions in cell cycle regulation Authors - Yin-Li Zhang View Article
human	WB	Oncotarget Screening key microRNAs for castration-resistant prostate cancer based on miRNA/mRNA functional synergistic network. Authors - Jin Zhu View Article
mouse	WB,IF	PLoS Pathog A murine cytomegalovirus cell cycle regulator (m54.5p) evolved within the conserved viral DNA polymerase gene. Authors - Yan Zheng View Article
human	WB	Sci Rep Reciprocal interaction between SIRT6 and APC/C regulates genomic stability. Authors - Helin Wang View Article