SLC25A2 Polyclonal antibody

SLC25A2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21764-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ORC2, ORNT2, SLC25A2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of mouse kidney using 21764-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 21764-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 21764-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 21764-1-AP (SLC25A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 21764-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 21764-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 21764-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 21764-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 21764-1-AP (SLC25A2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC25A2 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse kidney tissue, HeLa cells, mouse liver tissue
Positive IHC detected in	human liver tissue, human kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21764-1-AP targets SLC25A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16360 Product name: Recombinant human SLC25A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC100935 Sequence: TACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQ Predict reactive species
Full Name	solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2
Calculated Molecular Weight	301 aa, 33 kDa
Observed Molecular Weight	30-33 kDa
GenBank Accession Number	BC100935
Gene Symbol	SLC25A2
Gene ID (NCBI)	83884
RRID	AB_10858388
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BXI2
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for SLC25A2 antibody 21764-1-AP	Download protocol
WB protocol for SLC25A2 antibody 21764-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The SLC25A2 Polyclonal antibody (Cat# 21764-1-AP) has a total of 1 citation. It appears in PLoS One, in a study investigating the effects of canagliflozin on growth and metabolic reprogramming in hepatocellular carcinoma cells using multi-omics analysis. The associated research fields include hepatocellular carcinoma, metabolomics, and absolute quantification proteomics. The antibody was applied in Western Blot for human samples.

Species	Application	Title
human	WB	PLoS One Effects of canagliflozin on growth and metabolic reprograming in hepatocellular carcinoma cells: Multi-omics analysis of metabolomics and absolute quantification proteomics (iMPAQT). Authors - Dan Nakano View Article