LGI3 Polyclonal antibody

LGI3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21919-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

UNQ8190/PRO23199, LGIL4, LGI1-like protein 4, LGI1 like protein 4, Leucine-rich repeat LGI family member 3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis of HepG2 using 21919-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 21919-1-AP (LGI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 21919-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 21919-1-AP (LGI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse lung using 21919-1-AP
mouse lung tissue were subjected to SDS PAGE followed by western blot with 21919-1-AP (LGI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of A549 using 21919-1-AP
A549 cells were subjected to SDS PAGE followed by western blot with 21919-1-AP (LGI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 21919-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 21919-1-AP (LGI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung using 21919-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung using 21919-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 21919-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung using 21919-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung using 21919-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 21919-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 21919-1-AP
Immunofluorescent analysis of HepG2 cells using 21919-1-AP (LGI3 Antibody) at dilution of 1:50 and Rhodamine-labeled goat anti-Rabbit IgG (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LGI3 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HepG2 cells, mouse lung tissue, A549 cells, mouse liver tissue, SMMC-7721 cells
Positive IHC detected in	human lung tissue, human brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21919-1-AP targets LGI3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16257 Product name: Recombinant human LGI3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 343-524 aa of BC142997 Sequence: HQALHPWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRTQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGRRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHIVVDLSA Predict reactive species
Full Name	leucine-rich repeat LGI family, member 3
Calculated Molecular Weight	548 aa, 62 kDa
Observed Molecular Weight	55-62 kDa
GenBank Accession Number	BC142997
Gene Symbol	LGI3
Gene ID (NCBI)	203190
RRID	AB_10838807
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8N145
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for LGI3 antibody 21919-1-AP	Download protocol
IHC protocol for LGI3 antibody 21919-1-AP	Download protocol
WB protocol for LGI3 antibody 21919-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The LGI3 Polyclonal antibody (Cat# 21919-1-AP) has 1 citation. It appears in the American Journal of Human Genetics (2022), in a study on reverse genetics and genomics approaches to gene paralog function and disease, specifically myokymia and the juxtaparanode. The research field encompasses human genetics, genomics, and neuromuscular disease.

Species	Application	Title
mouse	IF	Am J Hum Genet A reverse genetics and genomics approach to gene paralog function and disease: Myokymia and the juxtaparanode Authors - Dana Marafi View Article