Tested Applications
| Positive WB detected in | Daudi cells, NCCIT cells, Raji cells |
| Positive IP detected in | Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24112-1-AP targets ZMYM2 in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21370 Product name: Recombinant human ZMYM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 166-252 aa of BC036372 Sequence: NAGMGNSGITTEPDSEIQIANVTTLETGVSSVNDGQLENTDGRDMNLMITHVTSLQNTNLGDVSNGLQSSNFGVNIQTYTPSLTSQT Predict reactive species |
| Full Name | zinc finger, MYM-type 2 |
| Calculated Molecular Weight | 1377 aa, 155 kDa |
| Observed Molecular Weight | 155-180 kDa |
| GenBank Accession Number | BC036372 |
| Gene Symbol | ZMYM2 |
| Gene ID (NCBI) | 7750 |
| RRID | AB_3742104 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q9UBW7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for ZMYM2 antibody 24112-1-AP | Download protocol |
| WB protocol for ZMYM2 antibody 24112-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ZMYM2 Polyclonal antibody (Cat# 24112-1-AP) has 2 total citations. One appears in the Journal of Medicinal Chemistry (2025), a study on IKZF1/2/3 degraders for hematological cancers, reflecting medicinal chemistry/oncology research. The other is in the International Journal of Molecular Sciences (2026), examining lactate-induced ZMYM2 K529 lactylation and platinum resistance in ovarian cancer, using WB in human samples—associated with epigenetics and cancer biology. Together, the citations span medicinal chemistry, oncology, and epigenetic regulation research fields.
| Species | Application | Title |
|---|---|---|
J Med Chem Discovery of Novel Potent Triple IKZF1/2/3 Degraders for the Treatment of Hematological Cancers | ||
Int J Mol Sci Lactate-Induced ZMYM2 K529 Lactylation Stabilizes ZMYM2 and Promotes Platinum Resistance in Ovarian Cancer.
|
