×
Use Able AI chat for product recommendations

PRPF39 Polyclonal antibody

PRPF39 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24480-1-AP
Publications (1)
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Pre mRNA processing factor 39, PRP39 homolog, PRPF39

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of K-562 cells using PRPF39 Polyclonal antibody (24480-1-AP)

    WB analysis of K-562 using 24480-1-AP

    K-562 cells were subjected to SDS PAGE followed by western blot with 24480-1-AP (PRPF39 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of Raji cells using PRPF39 Polyclonal antibody (24480-1-AP)

    WB analysis of Raji using 24480-1-AP

    Raji cells were subjected to SDS PAGE followed by western blot with 24480-1-AP (PRPF39 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of COLO 320 cells using PRPF39 Polyclonal antibody (24480-1-AP)

    WB analysis of COLO 320 using 24480-1-AP

    COLO 320 cells were subjected to SDS PAGE followed by western blot with 24480-1-AP (PRPF39 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human testis tissue using PRPF39 Polyclonal antibody (24480-1-AP)

    IHC staining of human testis using 24480-1-AP

    Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:400 (under 40x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human testis tissue using PRPF39 Polyclonal antibody (24480-1-AP)

    IHC staining of human testis using 24480-1-AP

    Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:100 (under 10x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human testis tissue using PRPF39 Polyclonal antibody (24480-1-AP)

    IHC staining of human testis using 24480-1-AP

    Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:100 (under 40x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human testis tissue using PRPF39 Polyclonal antibody (24480-1-AP)

    IHC staining of human testis using 24480-1-AP

    Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:200 (under 10x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human testis tissue using PRPF39 Polyclonal antibody (24480-1-AP)

    IHC staining of human testis using 24480-1-AP

    Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:200 (under 40x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human testis tissue using PRPF39 Polyclonal antibody (24480-1-AP)

    IHC staining of human testis using 24480-1-AP

    Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24480-1-AP (PRPF39 Antibody) at dilution of 1:400 (under 10x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Able AI
Able AI
What's the best dilution for PRPF39 in ?

Tested Applications

Positive WB detected inK-562 cells, COLO 320 cells, Raji cells
Positive IHC detected inhuman testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24480-1-AP targets PRPF39 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21683

Product name: Recombinant human PRPF39 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-348 aa of BC125126

Sequence: MEQSPDDSPNVNASTEETEMASAVDLPVTLTETEANFPPEYEKFWKTVENNPQDFTGWVYLLQYVEQENHLMAARKAFDRFFIHYPYCYGYWKKYADLEKRHDNIKPSDEVYRRGLQAIPLSVDLWIHYINFLKETLDPGDPETNNTIRGTFEHAVLAAGTDFRSDRLWEMYINWENEQGNLREVTAIYDRILGIPTQLYSHHFQRFKEHVQNNLPRDLLTGEQFIQLRRELASVNGHSGDDGPPGDDLPSGIEDITDPAKLITEIENMRHRIIEIHQEMFNYNEHEVSKRWTFEEGIKRPYFHVKPLEKAQLKNWKEYLEFEIENGTHERVVVLFERCVISCALYEE

Predict reactive species
Full Name PRP39 pre-mRNA processing factor 39 homolog (S. cerevisiae)
Calculated Molecular Weight 669 aa, 78 kDa
Observed Molecular Weight 75-85 kDa
GenBank Accession NumberBC125126
Gene Symbol PRPF39
Gene ID (NCBI) 55015
RRIDAB_2879563
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86UA1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRPF39 also termed as Pre mRNA processing factor 39 or PRP39 homolog is a 669 amino acid protein, which contains 7 HAT repeats and belongs to the PRP39 family. PRPF39 localizes in nucleus and may play a role in mRNA splicing.

Protocols

Product Specific Protocols
IHC protocol for PRPF39 antibody 24480-1-APDownload protocol
WB protocol for PRPF39 antibody 24480-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PRPF39 Polyclonal antibody (Cat# 24480-1-AP) has 1 total citation. The cited publication appeared in Discover Oncology (Impact Factor 2.8), published in 2025. The research field is oncology, specifically investigating prognostic implications of alternative splicing events and key splicing factors in head and neck squamous cell carcinoma. The antibody was used for Western blot (WB) on human samples.

Automatically generated from the 1 publication citations by Able AI.
SpeciesApplicationTitle
humanWB

Discov Oncol

Prognostic implications of alternative splicing events and key splicing factors in head and neck squamous cell carcinoma

Authors - Siyi He
View Article
||
New chat

Able™

正在加载，请稍候...