Tested Applications
| Positive IHC detected in | mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue, rat eye tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24660-1-AP targets OPN1SW in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20387 Product name: Recombinant human OPN1SW protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 265-348 aa of BC156719 Sequence: YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN Predict reactive species |
| Full Name | opsin 1 (cone pigments), short-wave-sensitive |
| Calculated Molecular Weight | 348 aa, 39 kDa |
| GenBank Accession Number | BC156719 |
| Gene Symbol | OPN1SW |
| Gene ID (NCBI) | 611 |
| RRID | AB_3085746 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P03999 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
OPN1SW (Short-wave-sensitive opsin 1) belongs to the G-protein coupled receptor 1 family, opsin subfamily. It's one of three types of cone photoreceptors responsible for normal color vision. Inherited tritan color vision deficiencies exhibit an autosomal dominant inheritance pattern and are caused by mutations in OPN1SW (PMID: 32400513).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for OPN1SW antibody 24660-1-AP | Download protocol |
| IHC protocol for OPN1SW antibody 24660-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The OPN1SW Polyclonal antibody (Cat# 24660-1-AP) has 3 citations. These appear in iScience, Neuroscience Letters, and bioRxiv. The associated research fields include retinal glucose transport and blood-retinal barrier biology (mouse), zebrafish optomotor response and motion perception, and human retinal development with cone terminal targeting and synaptic layer assembly.
| Species | Application | Title |
|---|---|---|
iScience Selective deletion of Slc2a1 from the RPE reveals that rods but not cones depend on glucose transport across the outer blood-retinal barrier. | ||
Neurosci Lett Color modulation of motion aftereffect on optomotor response in zebrafish larvae. | ||
bioRxiv mGluR6 coordinates cone terminal targeting and synaptic layer assembly during human retinal development. |
Reviews
What customers say
The single review rates the antibody 5 stars for use in immunohistochemistry and immunofluorescence on adult mouse retina and cone photoreceptor cells at a 1:500 dilution. The reviewer reports strong performance on both cryosections and paraffin-embedded tissues, noting that antigen retrieval is recommended for cryosections, with citrate buffer used for optimal results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Christoffer (Verified Customer) (02-19-2025) | The antibody performs well on both cryosections and paraffin-embedded tissues. However, to ensure optimal results, antigen retrieval is advised for cryosections. The citrate buffer antigen retrieval technique was utilized
|
