Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24775-1-AP targets SLC36A1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20594 Product name: Recombinant human SLC36A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC136437 Sequence: MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWF Predict reactive species |
| Full Name | solute carrier family 36 (proton/amino acid symporter), member 1 |
| Calculated Molecular Weight | 476 aa, 53 kDa |
| Observed Molecular Weight | 43-53 kDa |
| GenBank Accession Number | BC136437 |
| Gene Symbol | SLC36A1 |
| Gene ID (NCBI) | 206358 |
| RRID | AB_2918086 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z2H8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC36A1 antibody 24775-1-AP | Download protocol |
| WB protocol for SLC36A1 antibody 24775-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC36A1 antibody (Cat# 24775-1-AP) has 9 total citations across journals including Gut Microbes, Mater Today Bio, Free Radic Biol Med, ACS Appl Mater Interfaces, Commun Biol, J Gastroenterol, J Biol Chem, Photodiagnosis Photodyn Ther, and bioRxiv. Research fields span intestinal homeostasis, oral drug delivery, iron homeostasis, ferroptosis, cancer metastasis, glucose starvation resistance, porphyrin metabolism, and inflammaging. Applications include WB, IHC, and IF in human and mouse models.
| Species | Application | Title |
|---|---|---|
Gut Microbes A 4-guanidinobutanoic acid-SLC36A1 axis drives a microbiota‒host feedback loop to regulate intestinal homeostasis. | ||
Mater Today Bio Engineering micelles with hydrophilic-lipophilic balance to overcome intestinal barrier for oral therapeutic application. | ||
Free Radic Biol Med Glycine recalibrates iron homeostasis of lens epithelial cells by blocking lysosome-dependent ferritin degradation | ||
ACS Appl Mater Interfaces Betaine-Based and Polyguanidine-Inserted Zwitterionic Micelle as a Promising Platform to Conquer the Intestinal Mucosal Barrier | ||
Commun Biol Glycine alleviates ovarian granulosa cell ferroptosis induced by ERα-mediated internalization of polystyrene microplastics.
| ||
J Gastroenterol High-throughput screening identified miR-7-2-3p and miR-29c-3p as metastasis suppressors in gallbladder carcinoma.
|
