Tested Applications
| Positive WB detected in | rat kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26126-1-AP targets ECHDC2 in WB, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23510 Product name: Recombinant human ECHDC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 37-90 aa of BC044574 Sequence: GPDQGITEILMNRPSARNALGNVFVSELLETLAQLREDRQVRVLLFRSGVKGVF Predict reactive species |
| Full Name | enoyl Coenzyme A hydratase domain containing 2 |
| Observed Molecular Weight | 29-31 kDa |
| GenBank Accession Number | BC044574 |
| Gene Symbol | ECHDC2 |
| Gene ID (NCBI) | 55268 |
| RRID | AB_3085842 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86YB7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ECHDC2 (Enoyl-CoA Hydratase Domain Containing 2) is a protein-coding gene that encodes a mitochondrial enzyme. ECHDC2 is involved in fatty acid β-oxidation and branched-chain amino acid catabolism.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ECHDC2 antibody 26126-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-ECHDC2 antibody (Cat# 26126-1-AP) has 1 total citation. It appears in Frontiers in Genetics (IF: 3), published in February 2026. The study investigated the clinical significance and oncogenic role of ECHDC2 in glioblastoma using bioinformatics and in vitro experiments, with the antibody applied in Western blot (WB) on human samples. The associated research field is glioblastoma oncology.
| Species | Application | Title |
|---|---|---|
Front Genet Clinical significance and oncogenic role of ECHDC2 in glioblastoma: a comprehensive analysis based on bioinformatics and in vitro experiments.
|
