Tested Applications
| Positive WB detected in | mouse kidney tissue, HEK-293 cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26182-1-AP targets SLC13A3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24183 Product name: Recombinant human SLC13A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 568-602 aa of BC035966 Sequence: QTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL Predict reactive species |
| Full Name | solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 |
| Calculated Molecular Weight | 602 aa, 67 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC035966 |
| Gene Symbol | SLC13A3 |
| Gene ID (NCBI) | 64849 |
| RRID | AB_2880414 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WWT9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC13A3, also named NADC3 and SDCT2, belongs to the SLC13A/DASS transporter (TC 2.A.47) family and NADC subfamily. SLC13A3 encodes the plasma membrane Na+ /Dicarboxylate Cotransporter 3 (NaDC3), which imports inside the cell four to six carbon dicarboxylates as well as N-acetylaspartate (NAA). SLC13A3 is mainly expressed in kidney, but also in brain, liver, placenta and eye (PMID: 30635937). This antibody detected the 55-60 kDa band in SDS-PAGE. However, the 55 kDa (nonglycosylated) and 85 kDa (glycosylated) bands have been reported in the article (PMID: 27053689).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC13A3 antibody 26182-1-AP | Download protocol |
| WB protocol for SLC13A3 antibody 26182-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC13A3 Polyclonal antibody (Cat# 26182-1-AP) has 2 total citations. These appear in Cell Metabolism (2024) and International Journal of Molecular Sciences (2018). The cited research spans obesity-related breast cancer metabolism (IHC) and mitochondrial respiratory regulation in PTEN-negative prostate cancer (WB), both in human samples.
| Species | Application | Title |
|---|---|---|
Cell Metab Adipocyte-derived glutathione promotes obesity-related breast cancer by regulating the SCARB2-ARF1-mTORC1 complex | ||
Int J Mol Sci Succinate Accumulation Is Associated with a Shift of Mitochondrial Respiratory Control and HIF-1α Upregulation in PTEN Negative Prostate Cancer Cells. |
Reviews
What customers say
The single review for 26182-1-AP is positive, rated 4 out of 5. The reviewer used the antibody at a 1:100 dilution for immunofluorescence on mouse kidney tissue. They reported that it successfully marked a subset of proximal tubules in the P9 mouse kidney, indicating good specificity and performance for this application. Overall, the feedback suggests the antibody works well for detecting its target in developing kidney tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joo-Seop (Verified Customer) (07-23-2025) | It marks a subset of proximal tubules in the mouse kidney at P9.
 |
