Tested Applications
| Positive WB detected in | HeLa cells, mouse testis tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26250-1-AP targets TAOK1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22461 Product name: Recombinant human TAOK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 890-1001 aa of BC133039 Sequence: MVLSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT Predict reactive species |
| Full Name | TAO kinase 1 |
| Calculated Molecular Weight | 1001 aa, 116 kDa |
| Observed Molecular Weight | 116 kDa |
| GenBank Accession Number | BC133039 |
| Gene Symbol | TAOK1 |
| Gene ID (NCBI) | 57551 |
| RRID | AB_2880446 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7L7X3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Thousand and one kinase 1 (TAOK1), also known as prostate-derived sterile 20 (Ste20)-like kinase 2, TAO1 (thousand and one amino-acid protein 1) or MARKK, is a member of the MAP3K protein kinase and belongs to the germinal-center kinase-like class of sterile 20 (Ste20)-like kinases (PMID: 29400705). TAOK1 is involved in mammalian brain development and functions as a negative regulator in IL-17-mediated signaling and inflammation (PMID: 33565190). TAOK1 has a calculated molecular mass of 116 kDa and encodes a serine/threonine protein kinase at its N terminus.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TAOK1 antibody 26250-1-AP | Download protocol |
| IHC protocol for TAOK1 antibody 26250-1-AP | Download protocol |
| WB protocol for TAOK1 antibody 26250-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TAOK1 Polyclonal antibody (Cat# 26250-1-AP) has 10 citations published in journals including Nature Microbiology, Nature Communications, American Journal of Human Genetics, Science Signaling, Molecular Cancer Therapeutics, Acta Neuropathologica Communications, International Journal of Molecular Sciences, Journal of Cell Science, Molecular Carcinogenesis, and OncoTargets and Therapy. Research fields span innate antiviral immunity, RNA biology, neurodegeneration, cell cycle regulation, and oncology (breast, esophageal, and cervical cancers).
| Species | Application | Title |
|---|---|---|
Nat Microbiol Oxaloacetate sensing promotes innate immune antiviral defence against influenza virus infection.
| ||
Nat Commun Phenylalanine-tRNA aminoacylation is compromised by ALS/FTD-associated C9orf72 C4G2 repeat RNA | ||
Am J Hum Genet Variants in EXOSC9 Disrupt the RNA Exosome and Result in Cerebellar Atrophy with Spinal Motor Neuronopathy. | ||
Sci Signal Neurodevelopmental disorder-associated mutations in TAOK1 reveal its function as a plasma membrane remodeling kinase | ||
Mol Cancer Ther Targeting TAO kinases using a new inhibitor compound delays mitosis and induces mitotic cell death in centrosome amplified breast cancer cells. | ||
Acta Neuropathol Commun A new TAO kinase inhibitor reduces tau phosphorylation at sites associated with neurodegeneration in human tauopathies. |
