Use Able AI chat for product recommendations
  • KD/KO Validated

Pan-Keratin Polyclonal antibody

Pan-Keratin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, IF-P, ELISA
For FC, select conjugated version.

Pan CK, Pan Keratin, pan-CK, CK 5, CK-5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Pan-Keratin in ?

Tested Applications

Positive WB detected inA431 cells, MCF-7 cells, HeLa cells
Positive IHC detected inhuman colon cancer tissue, human lung cancer tissue, human renal cell carcinoma tissue, human brown disease, human cervical cancer tissue, human liver tissue, mouse colon tissue, mouse liver tissue, mouse skin tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman colon cancer tissue, human rectal cancer tissue
Positive IF/ICC detected inA431 cells, HeLa cells, mouse breast cancer

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:50000-1:200000
Immunohistochemistry (IHC)IHC : 1:1500-1:6000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26411-1-AP targets Pan-Keratin in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, rabbit, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24184

Product name: Recombinant human KRT5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 316-491 aa of BC024292

Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI

Predict reactive species
Full Name keratin 5
Calculated Molecular Weight 590 aa, 62 kDa
Observed Molecular Weight 46-58 kDa
GenBank Accession NumberBC024292
Gene Symbol Cytokeratin 5
Gene ID (NCBI) 3852
RRIDAB_2880505
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP13647
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pan-keratin, also known as pan-cytokeratin, refers to a group of antibodies that recognize a broad array of keratin proteins. Keratins are a large family of intermediate filament (IF) proteins that provide structural integrity to epithelial cells. These proteins are essential for maintaining cell shape, strength, and resilience. The keratin gene family is divided into two major groups: type I keratins (acidic) and type II keratins (basic), with 27 type I and 26 type II keratin genes in humans. Pan-keratin immunostaining is widely used in pathology and research due to its ability to detect a variety of keratin proteins, making it a valuable tool for identifying epithelial cells and tissues. This staining technique is particularly useful in the diagnosis of tumors, as it can help distinguish between epithelial and non-epithelial neoplasms. This antibody is a pan-keratin antibody.

Protocols

Product Specific Protocols
IF protocol for Pan-Keratin antibody 26411-1-APDownload protocol
IHC protocol for Pan-Keratin antibody 26411-1-APDownload protocol
WB protocol for Pan-Keratin antibody 26411-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Pan-Keratin Polyclonal antibody (Cat# 26411-1-AP) has 102 citations. Publications span journals including Nature Communications, Nature Cell Biology, Cancer Cell, Molecular Cancer, Science Advances, Advanced Science, Cell Death & Disease, Oncogene, EMBO Molecular Medicine, and Biomaterials. Research fields cover oncology (lung, gastric, ovarian, breast, pancreatic, colorectal cancers), tumor microenvironment, immunotherapy, fibrosis, epithelial biology, biomaterials, and tissue engineering. The antibody is primarily applied in IF, IHC, and WB.

SpeciesApplicationTitle

Cancer Cell

Conserved spatial subtypes and cellular neighborhoods of cancer-associated fibroblasts revealed by single-cell spatial multi-omics

Authors - Yunhe Liu
mouseIF

Mol Cancer

c-Rel drives pancreatic cancer metastasis through fibronectin-integrin signaling-induced isolation stress resistance and EMT.

Authors - D. Bakırdöğen
humanIF

Nat Cell Biol

Aberrant amino acid-sensing promotes immunotherapy resistance via the inflammatory cytokine-ZBTB5-mTORC1 axis

Authors - Junyu Xiang
humanIF

Cancer Res

Transfer of Damaged Mitochondria from Cancer Cells to Cancer-Associated Fibroblasts Promotes Tyrosine Kinase Inhibitor Tolerance in EGFR-Mutant Lung Cancer.

Authors - Tongyan Liu
humanIF

J Extracell Vesicles

Tissue-Derived Extracellular Vesicles Define Diagnostic Biomarkers for Renal Cell Carcinoma.

Authors - Xinrui Wu
humanIHC

Nat Commun

Spatial heterogeneity of MDSCs mediated by ANXA1-FPRs signaling drives immune suppression in OSCC progression.

Authors - Fengtian Li
Loading...
||
New chat

Able™

正在加载,请稍候...