Pan-Keratin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Pan-Keratin Polyclonal antibody, PBS Only (26411-1-PBS)

Pan-Keratin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 26411-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

Pan CK, Pan Keratin, pan-CK, CK 5, CK-5

• 

  WB analysis using 26411-1-AP (same clone as 26411-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26411-1-AP (pan-keratin antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 26411-1-AP (same clone as 26411-1-PBS)

  WB result of Pan-Keratin antibody (26411-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Pan-Keratin transfected A431 cells. This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:3000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:3000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 26411-1-AP (Pan-Keratin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brown disease using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:20000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brown disease using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:20000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung adenocarcinoma tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung adenocarcinoma tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 26411-1-AP (same clone as 26411-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 26411-1-AP (pan-keratin antibody) at dilution of 1:3000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human colon cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using pan-keratin antibody (26411-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CD8 antibody (66868-1-Ig, Clone: 1G2B10, green). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human colon cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using pan-keratin antibody (26411-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CD8 antibody (66868-1-Ig, Clone: 1G2B10, green). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human rectal cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human rectal cancer tissue using pan-keratin antibody (26411-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human rectal cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human rectal cancer tissue using pan-keratin antibody (26411-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 26411-1-AP (same clone as 26411-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using pan-keratin antibody (26411-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 26411-1-AP (same clone as 26411-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using pan-keratin antibody (26411-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 26411-1-AP (same clone as 26411-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using pan-keratin antibody (26411-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 26411-1-AP (same clone as 26411-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using pan-keratin antibody (26411-1-AP) at dilution of 1:250 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 26411-1-AP (same clone as 26411-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using pan-keratin antibody (26411-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse breast cancer using 26411-1-AP (same clone as 26411-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse breast cancer using pan-keratin antibody (26411-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 26411-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Pan-Keratin in ?

Chat with Able

---

Product Information

26411-1-PBS targets Pan-Keratin in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24184

  Product name: Recombinant human KRT5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 316-491 aa of BC024292

  Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI

• Full Name: keratin 5
• Calculated Molecular Weight: 590 aa, 62 kDa
• Observed Molecular Weight: 46-58 kDa
• GenBank Accession Number: BC024292
• Gene Symbol: Cytokeratin 5
• Gene ID (NCBI): 3852
• RRID: AB_2880505
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13647
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Pan-keratin, also known as pan-cytokeratin, refers to a group of antibodies that recognize a broad array of keratin proteins. Keratins are a large family of intermediate filament (IF) proteins that provide structural integrity to epithelial cells. These proteins are essential for maintaining cell shape, strength, and resilience. The keratin gene family is divided into two major groups: type I keratins (acidic) and type II keratins (basic), with 27 type I and 26 type II keratin genes in humans. Pan-keratin immunostaining is widely used in pathology and research due to its ability to detect a variety of keratin proteins, making it a valuable tool for identifying epithelial cells and tissues. This staining technique is particularly useful in the diagnosis of tumors, as it can help distinguish between epithelial and non-epithelial neoplasms. This antibody is a pan-keratin antibody.