Tested Applications
| Positive WB detected in | DU 145 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26863-1-AP targets RAF1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species |
| Full Name | v-raf-1 murine leukemia viral oncogene homolog 1 |
| Calculated Molecular Weight | 648 aa, 73 kDa |
| Observed Molecular Weight | 70-75 kDa |
| GenBank Accession Number | BC018119 |
| Gene Symbol | RAF1 |
| Gene ID (NCBI) | 5894 |
| RRID | AB_2880660 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04049 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Raf-1 proto-oncogene, serine/threonine kinase(RAF1), is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RAF1 antibody 26863-1-AP | Download protocol |
| WB protocol for RAF1 antibody 26863-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The 26863-1-AP RAF1 Polyclonal antibody has 27 citations published in journals including Nature Communications, Advanced Materials, Cell Discovery, Science Advances, Cell Death & Disease, Oncogene, iScience, and Heliyon. Research fields span oncology (hepatocellular carcinoma, glioma, melanoma, colorectal, gastric, and lung cancers), RAF/MEK/ERK and RAS signaling pathways, diabetic wound healing, liver development, neurology (epilepsy, traumatic brain injury, cognitive impairment), toxicology, virology, and osteoarthritis. Most studies utilized the antibody for Western blot in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Adv Mater In Situ Triggered Self-Contraction Bioactive Microgel Assembly Accelerates Diabetic Skin Wound Healing by Activating Mechanotransduction and Biochemical Pathway | ||
Nat Commun PAR3-mediated coordination of hepatocyte proliferation, maturation, and architecture in liver development and regeneration. | ||
Sci Adv HPIP is an essential scaffolding protein running through the EGFR-RAS-ERK pathway and drives tumorigenesis | ||
Cell Death Dis CYP8B1 inhibits hepatocellular carcinoma progression by repressing PAK4 transcription through inhibition of nuclear translocation of u-STAT1. | ||
