Home
Products
Primary Antibodies
RAF1 Polyclonal antibody, PBS Only (26863-1-PBS)

Filter: AllWBIHC

WB analysis of DU 145 using 26863-1-AP (same clone as 26863-1-PBS)
DU 145 cells were subjected to SDS PAGE followed by western blot with 26863-1-AP (RAF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26863-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 26863-1-AP (same clone as 26863-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26863-1-AP (RAF1 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26863-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 26863-1-AP (same clone as 26863-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26863-1-AP (RAF1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26863-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 26863-1-AP (same clone as 26863-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26863-1-AP (RAF1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26863-1-PBS in a different storage buffer formulation.

RAF1 Polyclonal antibody, PBS Only

Name: RAF1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 26863-1-PBS

RAF1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26863-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

c Raf, CRAF, EC:2.7.11.1, NS5, Proto oncogene c RAF

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

26863-1-PBS targets RAF1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species
Full Name	v-raf-1 murine leukemia viral oncogene homolog 1
Calculated Molecular Weight	648 aa, 73 kDa
Observed Molecular Weight	70-75 kDa
GenBank Accession Number	BC018119
Gene Symbol	RAF1
Gene ID (NCBI)	5894
RRID	AB_2880660
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P04049
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Raf-1 proto-oncogene, serine/threonine kinase(RAF1), is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration.