Tested Applications
| Positive WB detected in | 3T3-L1 cells, LNCaP cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27196-1-AP targets PIM1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25743 Product name: Recombinant human PIM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 244-313 aa of BC020224 Sequence: HDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK Predict reactive species |
| Full Name | pim-1 oncogene |
| Calculated Molecular Weight | 45 kDa |
| Observed Molecular Weight | 30-40 kDa |
| GenBank Accession Number | BC020224 |
| Gene Symbol | PIM1 |
| Gene ID (NCBI) | 5292 |
| RRID | AB_3742218 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11309 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PIM1 belongs to the Ser/Thr protein kinase family and the Pim subfamily. This family includes PIM1, PIM2, and PIM3, which share high sequence and structural similarity. PIM1 is a serine/threonine protein kinase that significantly promotes cell survival and proliferation, providing a selective advantage for tumorigenesis. PIM1 is expressed primarily in cells of the hematopoietic and germline lineages (PMID: 16186805).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PIM1 antibody 27196-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PIM1 Polyclonal antibody (Cat# 27196-1-AP) has 5 total citations. These appear in Phytomedicine, Journal of Biological Chemistry, PLoS Computational Biology, World Journal of Surgical Oncology, and Biochemical and Biophysical Research Communications. The cited research spans osteoarthritis and chondrocyte senescence, myeloid leukemogenesis, breast cancer mechanisms, diffuse large B cell lymphoma immune microenvironment, and airway inflammation in asthma models. Applications include WB and IHC in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Phytomedicine Wogonin ameliorates osteoarthritis by targeting the STAT3/PIM1 axis to attenuate chondrocyte senescence. | ||
J Biol Chem The ubiquitin ligase Triad1 influences myeloid leukemogenesis by regulating the integrated stress response. | ||
PLoS Comput Biol An integrative analysis reveals the mechanism of plastic stabilizers inducing breast cancer. | ||
World J Surg Oncol Role and mechanism of PIM family in the immune microenvironment of diffuse large B cell lymphoma | ||
Biochem Biophys Res Commun Allicin reduces airway inflammation and remodeling in a murine asthmatic model. |
