Tested Applications
| Positive WB detected in | A549 cells, MDA-MB-231 cells, Caco-2 cells, HEK-293 cells, HeLa cells, HEK-293T cells, SH-SY5Y cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue, human colon tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human lymphoma tissue, human liver cancer tissue |
| Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27226-1-AP targets FTO in WB, IHC, IF-P, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, bovine, hamster, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species |
| Full Name | fat mass and obesity associated |
| Calculated Molecular Weight | 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | NM_001080432 |
| Gene Symbol | FTO |
| Gene ID (NCBI) | 79068 |
| RRID | AB_2880809 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9C0B1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in the FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FTO antibody 27226-1-AP | Download protocol |
| IF protocol for FTO antibody 27226-1-AP | Download protocol |
| IHC protocol for FTO antibody 27226-1-AP | Download protocol |
| IP protocol for FTO antibody 27226-1-AP | Download protocol |
| WB protocol for FTO antibody 27226-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-FTO (27226-1-AP) has accumulated 284 citations across high-impact journals including Nature, Science, Nature Communications, Cell Reports, EMBO Journal, PNAS, and Molecular Cell. Research fields span m6A RNA epitranscriptomics, oncology (colorectal, gastric, ovarian, glioma, and others), ferroptosis, cardiology, neurology, metabolic diseases, immunology, and environmental toxicology. The antibody is predominantly used in Western blot, with additional applications in IHC, IF, IP, and RIP.
| Species | Application | Title |
|---|---|---|
Science Liver ALKBH5 regulates glucose and lipid homeostasis independently through GCGR and mTORC1 signaling | ||
Mil Med Res Downregulation of FTO aggravates osteoarthritis with obesity by erasing m(6)A methylation of PDP2. | ||
Cancer Commun (Lond) Targeting histone deacetylase suppresses tumor growth through eliciting METTL14-modified m6 A RNA methylation in ocular melanoma | ||
Nat Genet N6-Methyladenosine co-transcriptionally directs the demethylation of histone H3K9me2.
| ||
Nat Cell Biol The piRNA CHAPIR regulates cardiac hypertrophy by controlling METTL3-dependent N6-methyladenosine methylation of Parp10 mRNA. |
Reviews
What customers say
All five reviews rate this antibody 5 stars, exclusively for Western Blot. Users consistently praise its high specificity and clean results, with one noting "good specific image without non-specific binding." Others describe it simply as "very good," "excellent antibody," and of "good quality." The antibody was tested across multiple cell lines, including U2OS, HEK293T, AC16, and H9C2, with a reported dilution of 1:1000. Overall, reviewers express strong satisfaction with its performance and reliability in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xiaochen (Verified Customer) (07-08-2024) | Show good sepecific image in WB without non-specific bend.
 |
Katherine (Verified Customer) (09-25-2023) | Quality was good.
|
S (Verified Customer) (03-20-2023) | Very Good
 |
SU (Verified Customer) (03-22-2022) |
 |
P. (Verified Customer) (05-15-2021) | Excellent antibody!
 |
