Tested Applications
| Positive WB detected in | HEK-293 cells, MCF-7 cells, mouse cerebellum tissue, NIH/3T3 cells, MDA-MB-231 cells, PANC-1 cells, PC-3 cells, Raji cells, HEK-293T cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue, human prostate cancer tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27384-1-AP targets DVL1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26055 Product name: Recombinant human DVL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-416 aa of BC050454 Sequence: LGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELA Predict reactive species |
| Full Name | dishevelled, dsh homolog 1 (Drosophila) |
| Calculated Molecular Weight | 75 kDa |
| Observed Molecular Weight | 73-75 kDa |
| GenBank Accession Number | BC050454 |
| Gene Symbol | DVL1 |
| Gene ID (NCBI) | 1855 |
| RRID | AB_2880859 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14640 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DVL1 is one of three DVL homologous proteins (DVL1-3) widely expressed in embryonic development and in the adult central nervous system. Dishevelled proteins are a necessary component of the Wnt and planar cell polarity developmental signaling pathways. Overexpression of DVL1 has been linked to prostate and breast cancers through the Wnt signaling pathway.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DVL1 antibody 27384-1-AP | Download protocol |
| IHC protocol for DVL1 antibody 27384-1-AP | Download protocol |
| IP protocol for DVL1 antibody 27384-1-AP | Download protocol |
| WB protocol for DVL1 antibody 27384-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DVL1 Polyclonal antibody (Cat# 27384-1-AP) has 21 citations across journals including Nature Communications, Theranostics, Advanced Science, Science Advances, International Journal of Biological Sciences, and eLife. Research fields span Wnt/β-catenin signaling, oncology (hepatocellular, colorectal, cervical, and ovarian cancers), bone biology, neuroscience, cardiac remodeling, renal fibrosis, angiogenesis, and developmental biology. Applications cited include WB, IHC, IF, IP, and ChIP in human, mouse, and rat samples.
| Species | Application | Title |
|---|---|---|
Nat Commun Dishevelled-1 regulates global transcriptomic changes and associates with ETS1 transcription factor | ||
Theranostics Transcription factor AP-4 promotes tumorigenic capability and activates the Wnt/β-catenin pathway in hepatocellular carcinoma. | ||
Genes Dis Naked cuticle homolog 2 controls the differentiation of osteoblasts and osteoclasts and ameliorates bone loss in ovariectomized mice | ||
J Exp Clin Cancer Res ROS/PI3K/Akt and Wnt/β-catenin signalings activate HIF-1α-induced metabolic reprogramming to impart 5-fluorouracil resistance in colorectal cancer. | ||
Adv Sci (Weinh) ZER1 Restrains Pressure Overload-Induced Cardiac Remodeling by Targeting DVL2 for Gly/N-Degron-Dependent Degradation. | ||
Adv Sci (Weinh) The m6 A Readers YTHDF1 and YTHDF2 Synergistically Control Cerebellar Parallel Fiber Growth by Regulating Local Translation of the Key Wnt5a Signaling Components in Axons. |
