CoraLite® Plus 488-conjugated DVL1 Polyclonal antibody

• 

  IF Staining of MCF-7 using CL488-27384

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CoraLite® Plus 488 DVL1 antibody (CL488-27384) at dilution of 1:200.

• Featured Product
• KD/KO Validated

DVL1 Polyclonal Antibody for IF/ICC

Cat No. CL488-27384

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

Dishevelled 1, DSH homolog 1, DVL, DVL1

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27384 targets DVL1 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26055

  Product name: Recombinant human DVL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 283-416 aa of BC050454

  Sequence: LGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELA

• Full Name: dishevelled, dsh homolog 1 (Drosophila)
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 75 kDa, 73 kDa
• GenBank Accession Number: BC050454
• Gene Symbol: DVL1
• Gene ID (NCBI): 1855
• RRID: AB_3672810
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14640
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DVL1 is one of three DVL homologous proteins (DVL1-3) widely expressed in embryonic development and in the adult central nervous system. Dishevelled proteins are a necessary component of the Wnt and planar cell polarity developmental signaling pathways. Overexpression of DVL1 has been linked to prostate and breast cancers through the Wnt signaling pathway.