Tested Applications
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27585-1-AP targets TMEM119 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26269 Product name: Recombinant human TMEM119 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 119-218 aa of NM_181724 Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE Predict reactive species |
| Full Name | transmembrane protein 119 |
| Calculated Molecular Weight | 29 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | NM_181724 |
| Gene Symbol | TMEM119 |
| Gene ID (NCBI) | 338773 |
| RRID | AB_2880915 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q4V9L6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#27585-1-AP.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TMEM119 antibody 27585-1-AP | Download protocol |
| IHC protocol for TMEM119 antibody 27585-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TMEM119 Polyclonal antibody (Cat# 27585-1-AP) has 33 citations spanning journals including Nature Communications, Science Advances, Advanced Materials, ACS Nano, Cell Death & Differentiation, Journal of Neuroinflammation, and Glia. Research fields predominantly involve neuroinflammation and microglial biology, with studies on Parkinson's disease, Alzheimer's disease, stroke, traumatic brain injury, glioblastoma, multiple sclerosis, and spinal cord injury.
| Species | Application | Title |
|---|---|---|
Adv Mater Chemically Programmed Prodrug Nanoparticles for Precise Oral Dopamine Delivery to Deep Brain Regions in Parkinson's Disease. | ||
Nat Commun P-selectin axis plays a key role in microglia immunophenotype and glioblastoma progression. | ||
ACS Nano Probiotic Spore-Based Oral Biotherapeutics Promote Brain Targeting toward Gut-Brain Dual-Regulation for Parkinson's Disease Treatment. | ||
Adv Sci (Weinh) Artificial Microglia Nanoplatform Loaded With Anti-RGMa in Acoustic/Magnetic Feld for Recanalization and Neuroprotection in Acute Ischemic Stroke | ||
Sci Adv CD34+ cell-derived fibroblast-macrophage cross-talk drives limb ischemia recovery through the OSM-ANGPTL signaling axis | ||
Sci Adv Single-cell analysis of human basal cell carcinoma reveals novel regulators of tumor growth and the tumor microenvironment. |
Reviews
What customers say
Two reviews for this TMEM119 antibody show mixed results. One user reported successful immunohistochemistry on paraffin-embedded murine and human brain tissue, using a 1:500 dilution with HRP-based detection, and rated it 4 out of 5. Another user attempted immunofluorescence on PFA-fixed mouse brain cryosections at 1:200 (also testing 1:100 to 1:800) with overnight primary incubation, but found the antibody did not work under those conditions, rating it 1 out of 5. Overall, the antibody performs well for IHC but may be less reliable for immunofluorescence.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marion (Verified Customer) (07-15-2025) | Immunohistofluorescence (PFA-fixed cryosections) image of TMEM119 stained murine brain. Blocking step : 10 % Donkey Serum + 1% BSA + 0.02% Triton as blocking agent for 2 hours at RT Primary antiboby incubation time : 1 night / 4°C Secondary antibody : AlexaFluor 568 (ab175470 ; Abcam) ; 1/200 This antibody does not seem to work under these conditions.
 |
Hannes (Verified Customer) (07-27-2020) | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)IHC-P image of anti-TMEM119 (27585-1-AP) stained murine and human brain. The tissue was paraffin-embedded, formalin fixed. The tissue was then incubated with EnVision+ Single Reagents (HRP. Rabbit), undiluted for 1 hour at room temperature.
 |
